ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI0735c (NDH)

type II NADH:quinone oxidoreductase, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion during gametocyte and merozoite and ring and schizont and trophozoite
cytosol during merozoite and ring and schizont and trophozoite

Who localised this protein by microscopy?

van Dooren, G. G., Stimmler, L. M., McFadden, G. I.
Metabolic maps and functions of the Plasmodium mitochondrion. (2006 Jul, FEMS Microbiol Rev) PubMed / full text
   more detail about this publication

mitochondrion during gametocyte and merozoite and ring and schizont and trophozoite, cytosol during merozoite and ring and schizont and trophozoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10452

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFI0735c type II NADH:quinone oxidoreductase
MLVKFRKCGQANIFRSISNVRKIYNVAKNNLKNNKDIERKEKIIILGSGWGGFNFLLNIDFKKYDVTLISPRNYFTFTPL
LPCLCSGTLSVNVCTESIRNFLRKKNGYCGNYLQLECTDVFYEDKYINCIDIENNKVKLFYDYLIIAVGAKTNTFNINGV
DKYAYFVKDIDDALKIRKKFLDILEKCTLPNISNEEKKKMLHVAVVGGGPTGVEVTAEFADFINKEVKINYKDIFNFISI
SIIEGGNNLLPTFTQNISDFTKENFHNLNINVLTNYYVIDVDKHSFHIQSSLNKNEKKKLSYGLLIWASGLAQTTLIQKF
LKTIPVQANNAILKVDEKLRVIGIPSNNIYAIGDCKKIQPKLLHEHTNEIIKILTGNKLTSEALKLKQSELTKTFPQLSI
SKWDYEKNKKGEMTPQQFHDYLFEIDKNYKSPTPTAQNAKQEAYYLSNVFNNFIHTNQKFNIPSFIEKWKGSLAYIGNHQ
VVADLPYYELKGGRFSSTFWKVVYIQLLLSWKSRFHFFIDFIKTKWYGRPFIK

Gene-Specific Links for PFI0735c

General Sub-Cellular Localisation Links