ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI0550w (CRMP1)

cysteine repeat modular protein 1, a gene from Plasmodium falciparum

Compiled localisation
maurer's cleft during early trophozoite and ring and schizont and trophozoite
during not merozoite
erythrocyte cytoplasmic structure during ring and schizont and trophozoite

Who localised this protein by microscopy?

Thompson, J., Fernandez-Reyes, D., Sharling, L., Moore, S. G., Eling, W. M., Kyes, S. A., Newbold, C. I., Kafatos, F. C., Janse, C. J., Waters, A. P.
Plasmodium cysteine repeat modular proteins 1-4: complex proteins with roles throughout the malaria parasite life cycle. (2007 Jun, Cell Microbiol) PubMed / full text
   more detail about this publication

maurer's cleft during early trophozoite and ring and schizont and trophozoite, during not merozoite, erythrocyte cytoplasmic structure during ring and schizont and trophozoite
  • "Merged images of the fluorescence patterns of antisera detecting PCRMP1 (red) and the PVM antigen, EXP1C, or PfEMP1-ATS (green) as indicated show that PCRMP1 is exported to structures within P.falciparum A4-, 3D7- and T9-96-IE cytoplasm and colocalizes with PfEMP1 in the MCs of IEs. Nuclei are stained with DAPI (blue). PfCRMP1 and PfEMP1 colocalize in abnormal aggregates in the cytoplasm of T9/96 mature trophozoite-IEs."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: A4, 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: MC during young trophozoite, not during merozoite
  • Other genes localised in this publication: cysteine repeat modular protein 2, rhoptry-associated protein 1
  • "Furthermore, PfEMP1 and PfCRMP1 colocalize in an apparently abnormal pattern within one to three large aggregates in the cytoplasm of T9/96-IEs (Fig.5A) suggesting that T9/96 has a general defect in transport which affects the distribution of a number of parasite proteins normally associated with the IE membrane."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: T9/96
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: RBC cytoplasmic aggregates and MC during blood stages
  • Other genes localised in this publication: cysteine repeat modular protein 2, rhoptry-associated protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_14594

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFI0550w cysteine repeat modular protein 1
MFLIIYGIATLNIKNENNSHMPNFFENRYYVNNERGETLSSLNLDNIDNTYNHNNNNNNNNNISSSNYNKGILKRLDKSS
TVKELYRNKNRVLNKLKYKNIRKMKKRRRRRRRKKKKANIDKVNLSRNFLFSYIQKNLYYTRSYFNVSQLFSTLQIFLDQ
FCYPGLGRCIPYINKCLCYDKSKMKPKTAKSCLNNCGVISLCSGYPYGPGYKIIPNEFINNRKVVTCVVSSLQNKLDRTC
GYNKKLRFNENKIYCIPYDLLDMNLSGIYCVNNNKEKIFCKGFLRQIYTNLKEYEILDIAYHNFILNNPCNEHIYDDGTN
YKGCQDTSISGRKCLHWNSLNMEKVLPYLYLHNYCRNPEGLSYIYCYVDNNGIITREYCKSRSNIIFNNIAYSREKYFHF
DITMKNVSDFRIKLDNKPCNQRYFVNNHRINEFTYDKRNYTYHNINGEIALTISFKNFSYNTYYDYKLYICACFKYYYTN
DLVICSTDNYKVEIGSFLITKAYTDKDTNVFYLNRQYNLSFNINYEIIKNEIYIIKGDYAYECNHLRIIGNDNIHMITNM
NILFNYYKNQNFQKIHPPLEPNKKYSYIYSYFDPILDLSSILRKNELFINPQSSNIIKGYQNVDNLNNDGKTNSKSKFAK
NKHMLQNGSPNNNNNNNNNNNNNNNNNNSNNFMHSHNTTFQKLYNLKNGSNLICIKHQYNKFTYYYYSGKIIYDNKNFEH
TKYILKKGNKTHENLLYIQDISNCPDINFFSFSSTTCEFIDRVSTKEKYVHVFIIRYTSRLKMHSFIFPYDAYIKGYNRN
VNKTNTMIINNNVNTNTNMKNNNQGNILSNMNNNNNNQGNILSNMNNNNNNQGNILSNMNNNNNNQGNILSNMNNNNNNQ
GNILSNMNNNNNNGNILSNMNNNNNQENNLSNMNEIYYFFLKSMYFKTDNKITYLCSRTNNSNNPISLSLVLFSDLLFVR
YNEFAHHFEIFSEPTNVYNHYLDNDSYNNYIKKYCDTEEFLDNENMNKIISVWSHENDNYISFWLISSNALTPFFLLKFH
INSPRFTFLHFIKSEQNHNNNILLKLYIFNIIYGYVRIYITNNFINIILVKTASLYKHDKVACVENFYFNKEPYFILLYK
NNTITILNNNLNEIEFKNNNFNIYIMSIPLKVKCLSDKSVTCFILYKYQKMLWFQILFNLNEESNNVVPKHDLLTIDKQD
YHQKGILKKGSSNYHHNNYYGEDKKKKYNLLMSNDITIYIKYINTYIESDDELNLDNSTNITVINKLDEFIIYVSFKSSN
KLHIYSTDSSNNTIKYYKYIKNENISNYKINSIFTYSFSYNNYINLFVIKEGEVPSLCIFIHEYSSKTSISYKAKDIYIY
NKKVVLNPVIEGDKRQIKYFTLDYDKQLNDQFIHIDKTTGVLSFKFNTIKNLNVHLEIVMYGLFHIYNYKLNFKIVCDNG
YYYIFNDCFPCPQGYYNNINIIKTNVDFINKCMKCDKNKTTLIEKSSNKTDCLCNFGYEYIKNPSDPQEFICSPCTRGMY
KNTISNKLCDGNACTGNFTTSVIGAKNIIESTCFCKPGFYVTYDYRGIEFCKECLLHFYCPGNVIGIQKCPIHNETLQPE
KRINFDSLHGCFCKKGYEPINILNINKTGTRDEHYYKLFHNTYADKFKDINPKHICMECDIGYYKDTISFQPCKKCPNQS
TNKKYGSTSLNDCNTCHSGYYKNINKTCSTCLPNHFCVGDLLQKDLDKYSGDAVICPNNSVTKKPYTQNGTFKDCLCIEG
YIKNYQESYNINDHCKLVPLNFYKDSISNDLGTPCPVNSITLNVGAKTINECLCNKGYFYNVKKQQCEECPIGFYCPKIS
SKNNIKKPIKCPKNSSSIKKGMYISNNCQCNFGYTKYIHIDNNQSLLNNNIIKYDNKKTNKMFYSFLSNNYYNYKNKINY
INKSYNNRNLILLRNIQNKNAIYKKKKRKNVLCIRCPPMTYKGTISNDPCEACPLNSRTIESVNNSHIFFCLCNPGYYLH
EQMCKPCSFSKLYCTGENIYIISQSLYETALQEIKNIYVSKNNDMYKMILMNLTLYDYSQNVNINNNNNNNNNNNIHNNN
IYNIYNSINHYNNDNNIFVNPIVNNKLKHHNNIIYPPYNLLNSQVDTIPFLKKKYGNNINISNILDLNSLYKEPIQNNNN
LNTILKSFFHKDNENLIYVKYQNFVTCGKNTVIPLGVDSSYTFDDCKCKKGYYLKSKDINNSIKICEPCKTGTFKNYVGD
DTFCLHCPPKSTSLEGSIYPTHCFCKGGFFYSKGYCLECLEGALCKGGLNKNVMQRMKFNMENILITEKDHIKPHSNKNY
YLDKSVIDVVDVSEWKFIKCPIKGACLEKNKCHKSMNNYLCIECAKGYTNSFMTSLCVKCPNNITNMILLFLIYIIFCFI
IIIISYLNITSGFYRRSIHSIVIKIGVNYISSMLFIKVLEDSNVSVPISFIHFYNKMEKFLHMGENKKIVSVDCLLRYYF
NLNYSNSFFYSSVLFFFIPIFLIITLTIILFIILKIYQCVQKKQIANKLDLLRIAEIENIHFLASSLKKSYSRQRIIMIL
RYIHLDNYKTMDKIWIFFEDMIPVYVTFLFIIHAKTSLRMFQLFDCSYIKYTKYLGKYILRRASSVQCSFKEDYSKFFFL
GLTGTIIWSLGIPLFSFYILYINRHNLFNENVRIRYGFLHNGYVPNKWYWEIIVFSRKICVLFIMTVIIFPSDESNASQL
LLVTFVAIFSLCLHFIFQPFDKRNYFTLNKLENLSLYIWVSTIICTSILLSMNLSKLINFIILFTLFILNLLFFIKLLFC
LFFECLDNIRRSKACYHLPVLGTCAKLLGDIMEKKRKREPIIFYDKLCKQICIMLPVQCGKVPKNKKNNKIKINHNKYIK
NITYPFTRLFKNLSNSYKHNNIKKKNNYMPLQENINENKNDINNMCQNQNTQSYVTCSSDLDKNNIIQQKKSHNDNNINL
ITENIKNETKNNVCFYLSNSHNIPLYGGIKKEYRMFATEIYKELFDIFLKNISLTCVSDTFFEFLFKITINISNLIHTID
EKQKIFESFDQQHNFNNIIQWSLERKEKFNENKKYQQNDFISSKNYTSKNDNNIYPNNNINDFSSYNFECMQNNEINHNN
YINEFFIGHDKETKKNNQKNYISKEEKEKLFSFFSDDLLNRKVALSEFYFLLIELKLKYFRNLPSYFYMFKVYKKLEKNN
RLKQLRKLNNKLKICQTINDDKKILSTHDNMRLNEIKKSIPMLYKEFKILSKSIEKLKNEYLNLDKNYSRTYSSDDRKIT
DMNNVILSLSDNEILNFDTFKNE

Gene-Specific Links for PFI0550w

General Sub-Cellular Localisation Links