ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI0515w (Ykt6.1)

SNARE protein, putative, a gene from Plasmodium falciparum

Compiled localisation
cytosol and golgi apparatus during trophozoite

Who localised this protein by microscopy?

Ayong, L., DaSilva, T., Mauser, J., Allen, C. M., Chakrabarti, D.
Evidence for prenylation-dependent targeting of a Ykt6 SNARE in Plasmodium falciparum. (2011 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytosol and golgi apparatus during trophozoite
  • "By immunofluorescence analyses, the PfYkt6.1 protein appeared partly cytosolic and partly organellar as seen by its accumulation at multiple intracellular spots that were predominant at the trophozoite stage (supplementary Fig. S1). "
  • Microscopy type: Fixed Light, Live Light
  • Microscopy method: Rabbit antibody to YLTKYKDPLN, N terminal GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication, blast from YLTKYKDPLN, annotation matches
  • Localisation record: Golgi and cytosol during trophozoite
  • Other genes localised in this publication: ER lumen protein retaining receptor, heat shock protein 70

Orthology

OrthoMCL

Part of OrthoMCL group OG4_41240

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFI0515w SNARE protein, putative
MNLLAIFLTKYVEDVIFLCNATDLNSYSFIKKKAFKEAAFFVARTIPSRIEYNTKEIITHENNTVFAFKYEDNICPIVIA
TDDYPERVAFYMINEIYRDFISTIPKEEWSSVKQDNKISFNLYTYLTKYKDPLNCDAITQTNIKINENIEKVRVTMDALI
RNRENLDVLVDKSKDLSSTTKQLFKQSKKLKKKQCCSIM

Gene-Specific Links for PFI0515w

General Sub-Cellular Localisation Links