ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI0450c (ARP)

apoptosis-related protein, putative, a gene from Plasmodium falciparum

Compiled localisation
cytosol during ring and trophozoite
during schizont

Who localised this protein by microscopy?

Guha, M., Choubey, V., Maity, P., Kumar, S., Shrivastava, K., Puri, S. K., Bandyopadhyay, U.
Overexpression, purification and localization of apoptosis related protein from Plasmodium falciparum. (2007 Apr, Protein Expr Purif) PubMed / full text
   more detail about this publication

cytosol during ring and trophozoite, during schizont
  • "PfARP is a cytosolic protein as evident from immunofluorescence microscopy."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54
  • Gene model mapping comments: Blast from CAD51776, annotation matches
  • Localisation record: Cytosol during ring and troph, little during schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11059

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFI0450c apoptosis-related protein, putative
MNIEKAEAKSKLIEMSKQNIENKTKKELELKQKQEELLEKRRLILKSLLTPEAHARLSRIAIVKEEQARKIEDIIIRNSQ
MGLIYNKIDDDHLIKIIEQINDKIYKKDPVIEIRRRKQFDDDDDFNEEDYM

Gene-Specific Links for PFI0450c

General Sub-Cellular Localisation Links