ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI0230c (HU)

bacterial histone-like protein, a gene from Plasmodium falciparum

Compiled localisation
apicoplast and not mitochondrion during late trophozoite

Who localised this protein by microscopy?

Ram, E. V., Naik, R., Ganguli, M., Habib, S.
DNA organization by the apicoplast-targeted bacterial histone-like protein of Plasmodium falciparum. (2008 Sep, Nucleic Acids Res) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during late trophozoite
  • "PfHU specifically binds apicoplast DNA"
  • Microscopy type: Light, ChIP
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: Taken directly from paper
  • Localisation record: apicoplast and not mitochondria during late trophozoite
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13232

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFI0230c bacterial histone-like protein
MYVILYCVLFLFQVVYSRRAFINVHKNNIINNKLSVNNPYNKNALYQSSSKIPMSQAITKKQIIEEVSMETKENKKTVEK
IMNGIFDNIYKHLENNEKIYIHKFGMFYNIFRKKRCIKNLRTKEDIEIESSHMPHFKFSKVFKELIKQNVKVKKGKGVST
NDHDLDEDDMNMDNINESFKENVNEKLIY

Gene-Specific Links for PFI0230c

General Sub-Cellular Localisation Links