ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI0185w (CCp4)

LCCL domain-containing protein, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during female gametocyte and gamete and gametocyte stage i and gametocyte stage ii and gametocyte stage iii and gametocyte stage iv and gametocyte stage v
during not intraerythrocytic and not male gametocyte

Who localised this protein by microscopy?

Scholz, S. M., Simon, N., Lavazec, C., Dude, M. A., Templeton, T. J., Pradel, G.
PfCCp proteins of Plasmodium falciparum: gametocyte-specific expression and role in complement-mediated inhibition of exflagellation. (2008 Mar, Int J Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during female gametocyte and gamete and gametocyte stage i and gametocyte stage ii and gametocyte stage iii and gametocyte stage iv and gametocyte stage v, during not intraerythrocytic and not male gametocyte
  • "PfCCp expression patterns in mature gametocytes as determined by indirect immunofluorescence assay using mouse sera directed against PfCCp1 through PfCCp5 and PfFNPA. PfCCp1 through PfCCp3 show a punctuate pattern in mature gametocytes, whereas PfCCp4 is homogenously expressed in association with the parasite plasmalemma. No protein expression was detectable in asexual parasites for PfCCp1 through PfCCp4 and PfFNPA (Fig. 1b and Supplementary Fig. S1). Unlike PfCCp1 through PfCCp3, PfCCp4 protein is not released during emergence and later remains associated with the gamete plasma membrane (Fig. 2a)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54
  • Gene model mapping comments: Taken directly from publication, annotation doesn't match
  • Localisation record: Homogenous in association with the parasite plasmalemma during stage I gametocyte and stage II gametocyte and stage III gametocyte and stage IV gametocyte and stage V gametocyte, not during asexual, homogenously with membrane during macrogamete, not during microgamete, parasite membrane during gamete
  • Other genes localised in this publication: LCCL domain-containing protein, LCCL domain-containing protein, LCCL domain-containing protein, LCCL domain-containing protein, LCCL-like protein, 25 kDa ookinete surface antigen precursor

Orthology

OrthoMCL

Part of OrthoMCL group OG4_42846

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFI0185w LCCL domain-containing protein
MYNFFLSIICIFFIPYFCRASFKEYLSNKKIFLKYNGTYCLYPENVIENDIIEIATDECDKVAHEYENKIVWFSFDNGRL
RSNNGMCLKTYKNILVLSTCSPNKNEKSEMWKIDEETHLKNENNNCAQIAGNKLFSFTCNNLSTKEFEQSIFSSDELYLM
KTRYSQQKLKNIKTEDIDTFHNNFNTLTNSYKEVDTKIVHILNRDKEMKKQKEKILHLINDMKLLVNTSSSLNEYGTGAI
MKIYDNMDIEQKKYLLNVPLEKLEINEEKLDELGIEQGQIKIIIQSFLNVPENNTYTFYVKNIVGYINIKLNNEEILSNR
NIEINNRTNNSAVVKLRKNKLIPIYIEISSIGNEKPSFSLYWSNNNNMPEQIINSLYLYSTIYEKVCYTPLQKKIDFTLT
FENITKTNREYQFLCPLKNFNNDQNVRILKNENRPDYCYDLKSSICASAIDSYFLPNESEGIVKAVRQRIQNEKGIYEEC
GIILPTNTTEHIFKGITDIKLIDMDDFFINYEKNKELYKGYKGIVTDDKHSLLSKTDLDKSFISDIDINCTNNFNEKKTN
YEYSSGSFIIKRIKSSDLLKQNTSIVVDVFALFEKYSDIKNMPSIYLSNWTRKTCNDIQLYIKYGKPNDIMKYPSKLLSC
DDTFESLTYQSRDDNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNNNIISDYYDYDDDDTIVARCLPYCFNDKEVLGSYIY
MSKSPICKSAIHSGILTINGGLVEIRKLKNITQNFNSTMEITRNGIKATIGTNQNGYSYYITKPSGRFCNFPRTSYNINE
SINLESDIDYKNDEDKTNNNNNNNNNNNNNNNNNNYHNNNNYHNNYHNNNHPHNDNTIFPSFIQLYSKLTETPPVVLVHE
KHAVLPNQLDKIQNVYNQNNYKKDFFFPQKNEALNENKKKNPTSTPSDDEEKKENKKIIQEFTTFEKNYKKDIPHYQTLI
KKNENILSNLFMKKNSIKNMESQITDIRKNQKDSYDIFVKTQETVVTSLIKQFNIITKKKENHINRLEKAFSNVKTTTVK
IFKEQYKSTNINDNYIIIDSIQNNSMNGSSNWKIEKYTNGNFFSSITENSFIKSEDNIYGSYILYRYTKLYKGFISLDIK
LPYEGSFGIIFKYKDDKNYHNFIINRNEFYFLEVINGTVGNKINYTKTENNIYNFGMWIQIHLDFGNKYIRTFINKKFVC
GYETRYHTYGFLGFGVNHCKEKIFIDKLVIGSLDQTKYYSDKMGKKNNIQNIFPPTIYLNKNMQVLQNGTKKKKQNKNFI
FNKYNKEHTISIGNNNSNGCIPFEENFHTPLDNNWIIPENNNIWHIKRKETNIYLPSILKNFKNIYKNQDNSETNNISND
EENYLYSIKKTNQANNILIPSILLLNKQHLCTHMKSYTFQTNIKLNKISKAGIIFRVHSNHDFLSVILDISQKHGKIYLM
KITKGIPFQLLTKTHISIQDNTWYNLKLSYNGSNIKLILNDEIILNSKINQNMPKQLGTLGLILLSGQCKYKNVVFTPST
SSQ

Gene-Specific Links for PFI0185w

General Sub-Cellular Localisation Links