ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI0180w (A-tubulin)

alpha tubulin 1, a gene from Plasmodium falciparum

Compiled localisation
mitotic spindle in nucleus during schizont
microtubule during early gametocyte and schizont

Who localised this protein by microscopy?

Abdi, A., Eschenlauer, S., Reininger, L., Doerig, C.
SAM domain-dependent activity of PfTKL3, an essential tyrosine kinase-like kinase of the human malaria parasite Plasmodium falciparum. (2010 Oct, Cell Mol Life Sci) PubMed / full text
   more detail about this publication

microtubule during early gametocyte
  • "This showed that the GFP signal co-localises or closely associates with microtubules in the early stages of the gametocytes (Fig. 6b). "
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microtubules during early gametocytes
  • Other genes localised in this publication: serine/threonine protein kinase, sexual stage-specific protein precursor

Mahajan, B., Selvapandiyan, A., Gerald, N. J., Majam, V., Zheng, H., Wickramarachchi, T., Tiwari, J., Fujioka, H., Moch, J. K., Kumar, N., Aravind, L., Nakhasi, H. L., Kumar, S.
Centrins, cell cycle regulation proteins in human malaria parasite Plasmodium falciparum. (2008 Nov 14, J Biol Chem) PubMed / full text
   more detail about this publication

microtubule and mitotic spindle in nucleus during schizont
  • "Wide field and three-dimensional confocal microscopy show that the prominent tubulin structures are enclosed within the nuclear membrane and that these microtubules extend into the nuclear DNA (Fig. 6D). These results are in agreement with previous studies (7, 8, 52), and it is reasonable to infer that the anti--tubulin reactivity inside the parasite nucleus indeed labels the mitotic spindle."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: annotation matches
  • Localisation record: mitotic spindle in nucleus and microtubules during schizont
  • Other genes localised in this publication: centrin-1, centrin-2, centrin-3, centrin-4, heat shock protein 70

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10075

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFI0180w alpha tubulin 1
MREVISIHVGQAGIQVGNACWELFCLEHGIQPDGQMPSDKASRANDDAFNTFFSETGAGKHVPRCVFVDLEPTVVDEVRT
GTYRQLFHPEQLISGKEDAANNFARGHYTIGKEVIDVCLDRIRKLADNCTGLQGFLMFSAVGGGTGSGFGCLMLERLSVD
YGKKSKLNFCCWPSPQVSTAVVEPYNSVLSTHSLLEHTDVAIMLDNEAIYDICRRNLDIERPTYTNLNRLIAQVISSLTA
SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVVSAEKAYHEQLSVSEITNSAFEPANMMAKCDPRHGKYMACCLMYR
GDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTAIAEVFSRMDQKFDLMYA
KRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIESNEAEGEDEGYEADY

Gene-Specific Links for PFI0180w

General Sub-Cellular Localisation Links