ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI0050c (RIFIN)

rifin, a gene from Plasmodium falciparum

Compiled localisation
endoplasmic reticulum during early ring and trophozoite
maurer's cleft during late trophozoite and schizont

Who localised this protein by microscopy?

Khattab, A., Klinkert, M. Q.
Maurer's clefts-restricted localization, orientation and export of a Plasmodium falciparum RIFIN. (2006 Dec, Traffic) PubMed / full text
   more detail about this publication

endoplasmic reticulum during early ring and trophozoite, maurer's cleft during late trophozoite and schizont
  • "At the early ring to the trophozoite stage, the 3D7 transfectant showed a very distinct perinuclear staining, suggestive of an ER localization (Figure1E, top row)."
  • Microscopy type: Light
  • Microscopy method: C terminal GFP tag, internal GFP tag
  • Strain:
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: ER during early ring and troph, Maurer's Cleft during late troph and schizont
  • Comment: strain information not found
  • Other genes localised in this publication: skeleton-binding protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10216

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFI0050c rifin
MKLQYYKILLFSISLSIFFSSSYAHNKNKRYITPQTRTTTSRVLGECDLYMPNYDKDADMKSVKENFDRQTSQRFDEYEE
RMQEKRKKRKEQCDKDIQEIILKDKIEKSLEEKVEKCCLICGCGLGGGVTPFIGLFGGLAVNEMKKVAAVAATEVGIKEA
IKELGKIFELEAGSNMQWTKMINAGNYSQKMSLVEIVTILKNKCEEDEALAGPLFCKASKAATESGEVFEFSGNISRMAA
DAADAARKAANEKLAEMTSVGTICSNPVVISAIVVVIIAVILLIIYLILRYRRKKKMKKKEQYTKLLNQ

Gene-Specific Links for PFI0050c

General Sub-Cellular Localisation Links