ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFF1370w (PK4) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

protein kinase PK4, a gene from Plasmodium falciparum

Compiled localisation
apical and not parasite plasma membrane during merozoite and segmenter
during schizont and trophozoite

Who localised this protein by microscopy?

Mohrle, J. J., Zhao, Y., Wernli, B., Franklin, R. M., Kappes, B.
Molecular cloning, characterization and localization of PfPK4, an eIF-2alpha kinase-related enzyme from the malarial parasite Plasmodium falciparum. (1997 Dec 1, Biochem J) PubMed / full text
   more detail about this publication

apical and not parasite plasma membrane during merozoite and segmenter, during schizont and trophozoite
  • "Confocal microscopy detected the protein distributed throughout the trophozoite, whereas it was found in discrete foci (punctate distribution) in segmenters. PfPK4 co-localizes with P. falciparum 83 kDa antigen/apical membrane antigen-1 at the apical complex in segmenters and merozoites, but does not co-localize with rhoptry-associated protein-1."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein epitope from nucleotides 868-1049 and 1034-1123
  • Strain: K1
  • Gene model mapping comments: Blast from from X94118, annotation matches, gene model inconsistent, 5' RACE done
  • Localisation record: apex and not surface during segmenter and merozoite, diffuse during schizont and troph
  • Other genes localised in this publication: rhoptry-associated protein 1, apical membrane antigen 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20402

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFF1370w protein kinase PK4
MCNFIKKGIRFNGDKYIFLFDIFIKKYLLNVFVANILWEEENNICFLNRLKNKRKKSILFLKEEYLRYLMILNKEEKNKK
KRLKKIYECIKVFSIKEFRWLINKLEIIYFYFFCHLLLLCIFQNIFLLTYMSKEYFLKNIHDYMINILSNDIKFNTCIEF
THNDKYEQKCITMAYYDFLLNKKGKLKKRNKYYDIKNIEPLTGKDKNLYSYYNFSPFFPMSSSDIINVNTNDKISNILWN
DKYIDTLNHVNMKKKDIPLNIHSNNILMNNYAYRKYVRSYMIKKRINDLILYNLKNIFEKINNIEKLTNINNFMNFKKEY
EKVSKEVCNNNNNNYDPSDYMLILPNSSKDHALYNNINNDEYMYKKFCNFISQAREIKKQREKEKCHRDEKCDRGENYDR
GEKYDRDEKYDKEEKGLKEDNYRDVNEWNSNKSERCNKIYPSDYKFFLSEDKKYDTPYYSNERVDFHNSDIYMNDMDEEL
YYSSYHNNHHNNDITYNSNVYKRMLNEVIHPSVESNDVKKGPLNNDNIKNKESNVYEINDIIYQLNGEKKMNTNMCEKRG
NKIFDSNNFHNINERKKKILDENDMITIDNNIDKKENILFPYFHMEILKDNEMNITKYYKDKQYYGQYKYDENIYIYDLI
VLDTSGYIYKVSTDGSYHWKRKIVDHIQDYSNIEEKDDERKVLKKRNKLNEKDMYESNNKYESNMYDMNTYESNKYDINT
YDKNISDSTKAHQNIYVLKKNVYDMNYDSKRALKISPYHNYFNTSIINSINRDKLKHSKPLYKNNIKTNDDNKKLRENKT
KNKRLVSNYLGNLFYINENNEVIPLNINIKDVVNNSPFKSPLFPNMVFIGSRESTIINLDYDTGHVLRKYDEASNELLDK
PPKKKSRKNKSIKNVKDINDNMKLYKEGSQNVEELSFTEEENKKKSILEGEKIEVASLNNEENMNKGFVCEKDDKINNYD
NDEDDLFYEQYEDNNDNDNNKNDNNKNDNNKNDNNKNDNNNNNNNNNNNSYYYYNINGNASDDILVHSKNELLNNTYINK
TNIKDENSNNNESFLNKIDGMNNFKLLPKRNMKRNRKKNLLKRLMVSTNKLSMLLNRYHLINRSLERMRKDIKRGKNKRI
LKKRQLQISLIKWVIKAVDENTLKKKWITTWVDVGSIFMTDVHRKDTSFINSLIEIVGNKLILRPIEKDKMKSTTYQILK
IMNNDTDEIQMYRNEDMKYEVINNVDDINNVDNINNANNMNNVNNINNMNNMNNMNNMNNMNNMNNINNMNNINNMNNIN
NINNINNMNNILNDRLKNRINNKDNSNIKSKIFIFSESISSVFAVKYKNLSNIFTLDIIAKPNIKLYSDYDNLNNFTYNP
VHVKKERTLFLPFSKDISDLDGDKFSCSFEDNIIYGKRLIHRLNSISVNISSIEKDMKYLLSNIIYVYDKNKRIPISYIY
DMKNLIYEYQKVKQEFLYHLPWDEGDQKYLSRTDDVLNNSIIDNIGKKGPIFICEYINKFMDLYFEENDICYDYCSMLNI
WDKIFNNTVSDGDSLLLSNLYRVVHNAFKNNNKYNNNNIYFDNNINININSSSSSSSRSRRNIYNFDNYYNNRRDYNSFW
EDRHNILMNRENFLINTSTDKVFSGGKNNELKEFTSIRYKRRRWYWRVFYTIMFIIFFPVLFIYRRIIKRRKGSSKGNKI
GTSSNNKLIKKNRTFKDYEDDENNIMSEDEEDDLDMNYDLIFDDDRLKVKKIKRMRKNYNNNNNNNNNKNNNNISNNNSN
SNSKSNRFLSKLSNIDLANIDLNLIKKSHGKKMDNFEQPTLVDILARHARDSTHNDGVSYYPFNENETYNMLSLNYAWGG
NHKHMNVERTSEYNMGNISHQLNYNNIRNLGDNKISAYELDIYEKELFHLYRRRAASQDVLNKKSFVMKKRIRSSYKVGS
SNKYHKKNYTDNEKDKKKYRSYKEKHINEKMFDKKEFLNFLTNFNKKFMKKNSLVDHLIKMNDKAEDNYDGYNSSGSRYN
NINDDGVELCGTKRYTNNKNNSDYDNYNNNNNMKNKRYSNKKHNNDNIIINNNNNKYTDERKYRNKSIKEDVDYTNDYYN
IQLNNNKINNNQTKNKIDTIRNISHEKLGNNKSSSARNLSLIQTSHIPYDAPLADFLENGRFLRTFENISLIGQGGFGSV
YKVSHRLEPGSPTYAVKFIYLKVSSLDNVSSRRYFREIAANRDIYSKHVVRYYTWWCEEPQFLPMHLMPKEIQNLVKKNK
DTFKKRLTKNKKYSNNCISDSSNNNNSSCYSASSYNSSINSNYRNMKLWIKKKEQSPDMKRYKEVLRKNNAPNLVFYSDN
DGLTSKNKENPEKNHNPFLSDKNFSDSIYKKKKSHDYNSSSHKLKKRKNKKKKSKKKRKSKSKIKTNAQGIYEESENDEG
RDHFQYKKGKEQFSKFIGKHNSMGFTQSFQEYDPFDNGYLSEEDRDLIVFADNEESNGNDQQMIRHDNMNNENVIIKHRN
EDDKNGLDGDKNGLDGDKNGLDGDKNGLDGDKNGLDGDKNELDGDKNGLDGDKNGLDGDKNGLDGDKNELDDNTKKLDDN
TKKLDDLLMKQKINSLTRNDIVNIENENPAPHATNNIKNKKVDLNGELTYYDYVGKNEVIPNSRTETNVESINTNGMFNN
KFSVMKDEGGEYKKKENMTWGDTKRDGLYENGKHEKDGLGVNKCITNKYIENDDDDDDDDDNNNNNNNIDERKKDLKKKQ
KNAITKGNEDLLATNGTNNKEKRKKDDDINKNMEKIKSYKKKTPVPEFSIVLLLQMELCKGYTLRKWLDRSTRSDKPLHF
TYSDKKMNHPLEFDLFKQLIKGLKDIHATCFIHRDLKPENIFVDPDTYTLKIGDLGLVRFIEEKKREKDFNNIDCYKDNI
YTDINQNAITSQISIKGQIIGTPGYTAPEGGALCDEKADIYSAALILLELLCPRFTTIMERYKRLNDFRNYYTVPDYVKI
HLNPWYILMLQMSKPNPADRPSAADVYSKIKVLLDPHLTDFAFSFNDIHNEHMNKPPQGTNNFERITDNKDKFVIQSVVD
MKNKVENEEIPIEKGLNSNVENIKNENNGADK

Gene-Specific Links for PFF1370w

General Sub-Cellular Localisation Links