ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFF1130c (SOD2)

superoxide dismutase, a gene from Plasmodium falciparum

Compiled localisation
apicoplast and not mitochondrion during ring and schizont and trophozoite
mitochondrion during schizont and trophozoite

Who localised this protein by microscopy?

Pino, P., Foth, B. J., Kwok, L. Y., Sheiner, L., Schepers, R., Soldati, T., Soldati-Favre, D.
Dual targeting of antioxidant and metabolic enzymes to the mitochondrion and the apicoplast of Toxoplasma gondii. (2007 Aug 31, PLoS Pathog) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during ring and schizont and trophozoite

Sienkiewicz, N., Daher, W., Dive, D., Wrenger, C., Viscogliosi, E., Wintjens, R., Jouin, H., Capron, M., Muller, S., Khalife, J.
Identification of a mitochondrial superoxide dismutase with an unusual targeting sequence in Plasmodium falciparum. (2004 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion during schizont and trophozoite
  • "Immunofluorescence studies show that PfSOD1 is cytosolic, whereas the N-terminal extension of PfSOD2 targets a green fluorescent protein fusion into the parasite's mitochondrion."
  • Microscopy type: Fixed Light, Live Light
  • Microscopy method: antibody, GFP tag
  • Strain: 3D7
  • Gene model mapping comments: blast from AY586514, annotation doesn't match
  • Localisation record: mitochondrion during trophozoite and schizont
  • Other genes localised in this publication: Fe-superoxide dismutase

Orthology

OrthoMCL

Part of OrthoMCL group OG4_39374

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFF1130c superoxide dismutase
MNLKILLCSSIFLFFLKPNVPKGAYGLKNVCKLNFLNFNGFLPLYKTNKYFSKHDENLYESWDVKPLWNAKPFSLMKLPF
NPQDMSPFLSEEAIKYHYSKHHATYVKNLNNLSEQHKDLKSLTLEDIIKKYDGSIHNNAAQIFNHNFFWLGLKEQGGGMP
YGEIKEKLDESFNSFENFKNEFIKQASGHFGSGWIWLIIKDRKLEIFQGHDADSPIKQNIGKPILTLDIWEHSYYVDYKN
SRADYIKEWFNKINWDFANYNLSISS

Gene-Specific Links for PFF1130c

General Sub-Cellular Localisation Links