ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFF1105c (chorismate synthase, CS)

chorismate synthase, a gene from Plasmodium falciparum

Compiled localisation
cytosol and not apicoplast during ring and schizont and segmenter and trophozoite
cytoplasm during merozoite and ring and schizont and trophozoite

Who localised this protein by microscopy?

Read, M., Muller, I. B., Mitchell, S. L., Sims, P. F., Hyde, J. E.
Dynamic subcellular localization of isoforms of the folate pathway enzyme serine hydroxymethyltransferase (SHMT) through the erythrocytic cycle of Plasmodium falciparum. (2010, Malar J) PubMed / full text
   more detail about this publication

cytoplasm during merozoite and ring and schizont and trophozoite
  • "The donated apicoplast-specific antibody, anti-acyl carrier protein (anti-ACP; IgG) was raised in rabbits [37], as were the donated antibodies against the cytoplasmic enzymes chorismate synthase and cyclin-dependent protein kinase 5 [38]."
  • Microscopy type: Fixed Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm during erythrocytic stages
  • Other genes localised in this publication: serine hydroxymethyltransferase, putative, serine hydroxymethyltransferase, acyl carrier protein, protein kinase 5

Fitzpatrick, T., Ricken, S., Lanzer, M., Amrhein, N., Macheroux, P., Kappes, B.
Subcellular localization and characterization of chorismate synthase in the apicomplexan Plasmodium falciparum. (2001 Apr, Mol Microbiol) PubMed / full text
   more detail about this publication

cytosol and not apicoplast during ring and schizont and segmenter and trophozoite
  • "The appearance of a dispersed immunofluorescence pattern surrounding the nuclear stain and the absence of a discrete crescent-shaped signal clearly indicate that PfCS is cytosolic and not located to the apicoplast."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: DD2
  • Gene model mapping comments: Blast from AF008549, annotation matches
  • Localisation record: Cytosol and not apicoplast during ring and troph and schizont and segmenter
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11716

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFF1105c chorismate synthase
MSTYGTLLKVTSYGESHGKAIGCVIDGFLSNIEINFDLIQKQLDRRRPNQSKLTSNRNEKDKLVILSGFDENKTLGTPIT
FLIYNEDIKKEDYNSFINIPRPGHGDYTYFMKYHVKNKSGSSRFSGRETATRVAAGACIEQWLYKSYNCSIVSYVHSVGN
IKIPEQVSKELENKNPPSRDLVDSYGTVRYNEKEKIFMDCFNRIYDMNASMLKTDEYNKNTLTIPSIDNTYINVKTNECN
INQVDNNHNNYINDKDNTFNNSEKSDEWIYLQTRCPHPYTAVQICSYILKLKNKGDSVGGIATCIIQNPPIGIGEPIFDK
LEAELAKMILSIPAVKGIEFGSGFNGTYMFGSMHNDIFIPVENMSTKKESDLLYDDKGECKNMSYHSTIQNNEDQILNST
KGFMPPKNDKNFNNIDDYNVTFNNNEEKLLITKTNNCGGILAGISTGNNIVFRSAIKPVSSIQIEKETSDFYGNMCNLKV
QGRHDSCILPRLPPIIEASSSMVIGDLILRQISKYGDKKLPTLFRNM

Gene-Specific Links for PFF1105c

General Sub-Cellular Localisation Links