ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFF0995c (MSP-10)

merozoite surface protein 10, a gene from Plasmodium falciparum

Compiled localisation
during not ring
parasite plasma membrane and rhoptry during extracellular merozoite and late schizont and trophozoite

Who localised this protein by microscopy?

Black, C. G., Wang, L., Wu, T., Coppel, R. L.
Apical location of a novel EGF-like domain-containing protein of Plasmodium falciparum. (2003 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

during not ring, parasite plasma membrane and rhoptry during extracellular merozoite and late schizont and trophozoite
  • "No fluorescence was detected in ring-stage parasites, but trophozoites, schizonts and free merozoites were observed to fluoresce. Staining was observed in a rim-like pattern around the circumference of trophozoites and merozoites (both within intact schizonts and as free merozoites released from a rupturing schizont), an appearance indicative of the membrane location. Of interest, staining appeared to be more pronounced at one end of the free merozoites (Fig. 4)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Blast from AF403477, annotatation matches
  • Localisation record: not during ring, surface and rhoptry during troph and intracellular merozoite and free merozoite
  • Comment: merozoite surface protein 10 (MSP-10, Black et al., 2003)
  • Other genes localised in this publication: rhoptry-associated membrane antigen, merozoite surface protein 1, merozoite surface protein 8

Orthology

OrthoMCL

Part of OrthoMCL group OG4_40379

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFF0995c merozoite surface protein 10
MMFFKCNQVFTLVFLLLLYFNNIVYTHVDDIKNTSQKKITYDKYNKNKENMNNEKNDNKDNKDNIYNDNINNDNINNDNI
NNEDEYKFLSMKHYKDSLSNKLNNENDHMNYLIRKRKDNTQGSQHFNENIENNENVENNENIENNENNENIENIENNENN
ENNENIENNENNENNENSSIMNSESYNNIINSNEHNEEQIKKKEEDLIEAFFPFILKKLDNESLSLDNKYDDYYNLPNDH
NDTHKENSSDHNLLGYKLGNNLKSYLIEENDVSQKKTDDINESASSDSENIQEILSTDSNTSHLKERKNQKAPPGEHKPE
VKNALLNSQVASPKGEDEKKSQPQHPLVNSGDQLQHPKEIDENAEKIRRTLLKESRDIKNTTAIIDETVYKFEQLIMKGR
YYATAVRNFVIFKVNYICEYSKCGPNSRCYIVEKDKEQCRCRPNYIVDMSVNYFKCIPMKDMNCSKNNGGCDVNAECTIV
EGAVKCQCSHLYFGDGVFCVKNSQTKQTLYILFIVILLVFQNFFI

Gene-Specific Links for PFF0995c

General Sub-Cellular Localisation Links