ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFF0860c (H2A)

histone H2A, a gene from Plasmodium falciparum

Compiled localisation
nucleus during extracellular merozoite and intraerythrocytic and ring and schizont and trophozoite
cytoplasm during intraerythrocytic

Who localised this protein by microscopy?

Hossain, M. J., Korde, R., Singh, P. K., Kanodia, S., Ranjan, R., Ram, G., Kalsey, G. S., Singh, R., Malhotra, P.
Plasmodium falciparum Tudor Staphylococcal Nuclease interacting proteins suggest its role in nuclear as well as splicing processes. (2010 Nov 15, Gene) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during intraerythrocytic

Bartfai, R., Hoeijmakers, W. A., Salcedo-Amaya, A. M., Smits, A. H., Janssen-Megens, E., Kaan, A., Treeck, M., Gilberger, T. W., Francoijs, K. J., Stunnenberg, H. G.
H2A.Z demarcates intergenic regions of the plasmodium falciparum epigenome that are dynamically marked by H3K9ac and H3K4me3. (2010, PLoS Pathog) PubMed / full text
   more detail about this publication

nucleus during extracellular merozoite and ring and schizont and trophozoite
  • "(C) Immunofluorescent assay showing nuclear localisation of the ectopically expressed Ty1-H2A protein at all stages of the intra-erythrocytic cycle."
  • Microscopy type: Fixed Light
  • Microscopy method: antibody to Ty tag
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: nuclear during ring and trophozoite and schizont and free merozoite
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10041

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFF0860c histone H2A
MSAKGKTGRKKASKGTSNSAKAGLQFPVGRIGRYLKKGKYAKRVGAGAPVYLAAVLEYLCAEILELAGNAARDNKKSRIT
PRHIQLAVRNDEELNKFLAGVTFASGGVLPNIHNVLLPKKSQLKAGTANQDY

Gene-Specific Links for PFF0860c

General Sub-Cellular Localisation Links