ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFF0775w (PdxK)

pyridoxine kinase, a gene from Plasmodium falciparum

Compiled localisation
cytosol during schizont

Who localised this protein by microscopy?

Muller, I. B., Wu, F., Bergmann, B., Knockel, J., Walter, R. D., Gehring, H., Wrenger, C.
Poisoning pyridoxal 5-phosphate-dependent enzymes: a new strategy to target the malaria parasite Plasmodium falciparum. (2009, PLoS One) PubMed / full text
   more detail about this publication

cytosol during schizont
  • "Furthermore, the antiplasmodial effect of PT3 is directly linked to the capability of Plasmodium to trap this pyridoxyl analog, as shown by an increased sensitivity of parasites overexpressing PfPdxK in their cytosol, as visualized by GFP fluorescence."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Blast from primer GAGACCTAGGCTATTTTTCGAACTGCGGGTGGCTCCAAGCGCTAAAAAAAACAGGCTCTTCTTTAATTAAAATATC, annotation matches
  • Localisation record: cytosol during schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10836

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFF0775w pyridoxine kinase
MKKENIISIQSQVFDGFCGNNIAAFVFRRRGHIPKILNTVQYYSKFKHSGVELNSQEVDIILSEYNKDQEFMNDSNIYFL
TGYIKNAECVDMVTKNILELRRKRKIHRGKSNDNGNMNGHMNGHMNGHMNGHMNGHMNGHMNGHMNGHMNGHMNGHMNGH
MNGHTNGHMNGHMNDHMNGHMNGHTNDHMNGHTNDHMNGHTNDHMNGHTNDHMNDHMNGHTNDHMNDHMNDHMNGHTNSH
THGLTNGHMDEPNGEHPYRLMNSNELKSSHQIIPQGKQIHEKDMLKNNILTISQGRKKDEELYFIENIINLNFLWVCDPV
MGDNGRLYVDERVVESYKKAIEYVDIITPNQYETELLCGIKINEEKDVIKCLDVLLHKGVKIVIITSVNYNFDKDHLFLY
VSFFNNKNKIVYFKYKILKIHFNCFGSGDLFSCLLLSFIVKQKGNILHIISKVLNIVQNVIKNSLTGLELNIIENQDIIA
SDGLINDILIKEEPVFF

Gene-Specific Links for PFF0775w

General Sub-Cellular Localisation Links