ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFF0730c (FabI)

enoyl-acyl carrier reductase, a gene from Plasmodium falciparum

Compiled localisation
apicoplast during 60 hours after sporozoite invasion of hepatocyte

Who localised this protein by microscopy?

Yu, M., Kumar, T. R., Nkrumah, L. J., Coppi, A., Retzlaff, S., Li, C. D., Kelly, B. J., Moura, P. A., Lakshmanan, V., Freundlich, J. S., Valderramos, J. C., Vilcheze, C., Siedner, M., Tsai, J. H., Falkard, B., Sidhu, A. B., Purcell, L. A., Gratraud, P., Kremer, L., Waters, A. P., Schiehser, G., Jacobus, D. P., Janse, C. J., Ager, A., Jacobs, W. R. Jr, Sacchettini, J. C., Heussler, V., Sinnis, P., Fidock, D. A.
The fatty acid biosynthesis enzyme FabI plays a key role in the development of liver-stage malarial parasites. (2008 Dec 11, Cell Host Microbe) PubMed / full text
   more detail about this publication

apicoplast during 60 hours after sporozoite invasion of hepatocyte
  • "Proper targeting of PfFabI-V5 to the apicoplast was illustrated by colocalization of the V5 epitope tag of the mutant protein and ACP."
  • Microscopy type: Light
  • Microscopy method: V5 tag
  • Strain:
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: apicoplast during 60 hours after sporozoite invasion
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13747

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFF0730c enoyl-acyl carrier reductase
MNKISQRLLFLFLHFYTIVCFIQNNTQKTFHNVLQNEQIRGKEKAFYRKEKRENIFIGNKMKHLNNMNNTHNNNHYMEKE
EQDASNINKIKEENKNEDICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMIIDKDKKMN
ILDMLPFDASFDTANDIDEETKNNKRYNMLQNYTIEDVANLIHQKYGKINMLVHSLANAKEVQKDLLNTSRKGYLDALSK
SSYSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRNYNIRINTISAGPLKSRAA
TAINKLNNTYENNTNQNKNRNSHDVHNIMNNSGEKEEKKNSASQNYTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLS
RESRAITGQTIYVDNGLNIMFLPDDIYRNENE

Gene-Specific Links for PFF0730c

General Sub-Cellular Localisation Links