ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFF0575c ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11313

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFF0575c conserved Plasmodium protein, unknown function
MEGSFRSADKRNSSCVRKVDAMQNEMKAVENNINSTSNISSSSNASFMKNFNNYDIPEQFINYSSEFKDSYAEEHLNSYE
YNLGMNNNHMNNANMYMKNNDGYNNYYKMNDMLGGIILPNNNQLNNMDNMNNMDNMNNMDDMNNVDDMNNMDNMNNMDDM
NNVDDMNNVDDMNNMDDMNNMDNMNNMDNMNNMDNMNIIDNINNVDNINNVDNINNVDNINNVDNINNVDNINNVDNINN
VDNINNVDNINNVDNINNMNNMYHMNNINYMNRINNMSYLNNTIPLNCINVFNHINDNLRNNLISYNNNNNDDEQMNCNK
NVEHNNNNMDGTNNSNMNYSNNEGSNIAPNIYLNKNSGYENCYEINENSDKVTIGSYNNEDNKFNMNKMHVIKNEMDGNA
NDNKIENEDVNIPICGSSKSPLNIQNNNIEINHMRDNFLSNDIMNTIPYSPPTKKIKIEKRMMMKNIMHPNVIKNMDENN
MDMDKMSANNIDMNKMSVNNIDMNKMCATNVDINKMSVNNIDINKMCGNNIDINKMCGNNIDMDHMNSNNNDLINMNKYN
IHMNINNKIPNKFDANENIRIGKTDHPKYLNGKDYAYTRSCYNENNIEYNENENNDIKGNKNIIRKNNIMNFNTNNNNNN
NDNDSSNNNNNSNNNNNSNNSNNNINNNNSNNSNNNNNNNNNNNNNNNNNNNKNNNNNSNNNNNSYNNNNSNNNNNAQIT
YGENIYSTSNYQNNNFYEKNNFVEIKRININENFCDEKNKELKKNMVPKNQDTLNEVTNKILINKNAELTNQKNLKKKMR
ANINACLSGSNNNINNNNIIFYNEFIKDDNYYNNICLNNEELNNNNNNNILFNDNKNCNYKNLHLNSTINFNRNNNNNNI
DNNNNNININNNININNIKNNNDYYIKYNNLNEFKEEEEKEEKEKEKEKKKIEKKDNEKEKEKLPNEQEEEQQREIIKKG
KTQNINSNKKITKCINSSNSSSYLMNYDNNNNNYIKENTKNLAEFQNINNINNLTSNNCPHVLNVSSLNVKNMENQMARN
NSSFNNINNNHLNNDMHNFNQHLHNLKHINNPINLSTHGSLQKNNVQMRMNTKKIVPEENIEMESFMNINKNSSNINFIE
HNMMNNNINAYYNNNNNNMINNGTNETPKRTHRASLNIMQNINIPQKNNFTLNSNKNDVVMNNINSYHVQHVNYEDMENK
NAYPKNFINNLENHQMTTTIDGNKKRVSEHSGDLNRMLNNNLNTPPNNINNTNNINNINNINNNVNIVKGKTVQMNSPLK
NMTNSLHANNYNINKMMVYPPQNIITHGNTTTNITTTNNNNNNNNNNSGYNNNVYPYDNKVDNSNNNPTNNDFINHLNND
TQNRKKYLASSHAANMQNSGNHVYINNISINNNVNNMKNNNMNNNNNMISKNSLANINNNNNMNNMNNKMNHMNNMNNMN
NNMNNLNNSINNNNMNNINVGNNVLVGYKNVSNNNRNINNDNNNVILNPNYDMISRNENTQNNNLNMANVQNVYSNNNTG
GFLVNKDYVVNKNMINENKVSNLETTHPYNHIDNKMMTDFNNNNNNSNINNNKSGANINYNNMYNQNIHNRMNNTNTIVQ
NNVRSSILLNNKNNSNSSNNNNLPYDKENVTNIKYDLLNNKNVHNNIPFIGTKINLNNSLVQLNNNMNKNILSEDINKNG
DILNSFNGNALPINYDRNEYASSYSEKNTNINETYMNSMINSKNNSIHLNQMFTKNTITSNKNSSNEKQIMNRKKLTKTQ
NINNLKATDINSNINFINHINNNSDVKRMSNFNIHRDGMYLKDEQNTVTQDIKKVCTNISSNYGSLNYVNRDMMNQSKNN
NTINNNVNNNNTINNNVNNTNMINNNVHNTNMINNNANNTNMIHHNMNNTNMIHHNMNNTNMINHNMNNTNMINHNVNNT
NMINHNVNNTNMINHNVNNNNNMAGNNFVVGLLRNENHSKDHEIPNNLGNMNNYSEYVKNNYSVVNDPKVLNANNKENTN
SPYNNTSHDRVNNNNNNNKYNNNYNKTIDHASSNNNIASSSCVNLKNLININKNFNVLMNNINVDQSSLNMNAQSNNMYD
SYGKENIGIINNMENQEQLENNSNNMMYASNRSLINPYMNIMNMKGNVNMNNNMNNNMNNSMNTNMNNNMNNSMNNSMNN
NMNNNMNNNMNNSMNNNMVLNRNSLSLNNMNLMNDLNLNGNSYVDYKFNGNIPNEELYNLHMIQNNDIKNNLKKVVPKRR
KQENKSNESPNTVNVLGGTKRPRKKKKDNVSSESSNNELLLKNKKMSKSTKGRKPKDKNLSQPNVHEELNNSYISNDNSS
NVLNKNIMDNMGNDIKNDVKNDVKNDIKNDIKNDIKNDNQYVNNMTLNNATSASSVSANNNISQMNNLYSDESKAYNTYN
MNQKYINDNIQMNNNIIPVNNNNNNINTTTNNNNNNNNNMHDNQMNEKIITNKSKTMSTTKNVLYEQKYERNHSENMSIY
MKNVMHANDKLSNSNVSMKKDTSSLYPNKLEIQAQMNNIHKDNQLLQNRYNVNNNEGNNNVINKSQGTHGNDSTMNNANI
YTYVDEIFGDPNNINKVNSHNENVNKSVDQNINTNINTQPNTDLNTDMNTDMNTDVNTDVNTHLNTHINTDINTDINTDI
NTDINTDINTDINTHINTEINTDINTYINTDINTDINTDINTDINTDINRHISADIKYENNNIPDSSRNVQGTICEDEQK
KIHKLENVPKVENDNVQLNKDHLNNNKNLNEMNRGEEYAHNVTLSTDNQSNEYKNNIENNADVVEQNMDDNNNNMDMNDS
HLNDMNKVINITNNSVINKSFVEIMENEYPDDAFENVNDNNRDEKVISCNENFVHKENNIIILSKNTEDSNANMYQIKNR
AFDIYLNESTKNRIETDKNNNNVNDNVNDNVNDNVNDNDNDNDINRMNSNDDNMESHKIYNNNENVNSNNNFDSSNANNN
QLEENLRNGISTTDCADCADSLVTSNSNIGEEFNEGSAVLIGSFSDHVHIHMDENEILRNQMKDDILDNLININFKDEIK
RIIQNAEATFNINEQSEQIIFNIFKQVDNSNFLEILKEVMVKKNNLSNMDYFKITNYERKIINHKNFVHNSNRSKLVTLQ
YEENDQNNTSRNMNCIVRSENCLLGSDKKKIIDKIINSNFDITLTSTSLASTSIVNTFKEDEYELLDSFTCEYFCFSVCV
KNEFNTYLEFYKNIVRPDNNDDESGKFYIRAQCKDYDTFFESFVDFLI

Gene-Specific Links for PFF0575c

General Sub-Cellular Localisation Links