ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFF0370w (Coq2)

para-hydroxybenzoate--polyprenyltransferase (4- hydroxybenzoate octaprenyltransferase), putative, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion

Who localised this protein by microscopy?

van Dooren, G. G., Stimmler, L. M., McFadden, G. I.
Metabolic maps and functions of the Plasmodium mitochondrion. (2006 Jul, FEMS Microbiol Rev) PubMed / full text
   more detail about this publication

mitochondrion

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10710

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_010610 para-hydroxybenzoate--polyprenyltransferase,put at ive
  • PY01399 4-hydroxybenzoate octaprenyltransferase
  • PVX_113540 para-hydroxybenzoate--polyprenyltransf erase (4- hydroxybenzoate octaprenyltransferase), putative
  • PCHAS_010670 para-hydroxybenzoate--polyprenyltransferase,put at ive
  • PKH_114180 para-hydroxybenzoate--polyprenyltransferase,putative
  • TGME49_059130 4-hydroxybenzoate octaprenyltransferase, putative
  • NCLIV_027400 hypothetical protein
  • cgd3_2460 UbiA prenyltransferase family member (3I27) , putative
  • Chro.30285 UbiA prenyltransferase family member (3I27)
  • CMU_001010 4-hydroxybenzoate octaprenyltransferase, putative
  • TA18290 4-hydroxybenzoate octaprenyltransferase, putative
  • BBOV_III000400 prenyltransferase, UbiA family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFF0370w para-hydroxybenzoate--polyprenyltransferase (4- hydroxybenzoate octaprenyltransferase), putative
MQKPYLQHFFKNLKKYEKKQTSFYILPNNKRIKNEEPICGYYNYCTFKRIKLRSHNNINNTHYNICNNNNNNKEEEEGER
ERYFLFNKKHFTCKAYKIKGNVFNISYEPYNIYDDNKFLNYKNNLKLYEHKMITLQRCYYSEYIDKHTKNKNKELYDPIK
NLQKYKHNNDHNDDNNNNNNNNNNKDDIYNSKMCLQNKLRDMLIFNIKNYIILSRLHIPAGIYLLFYSSLYGYFLTYDMN
NLLINNNILNMNEIQHILKNIGLFLFGSINTRITGCIINDLLDKNFDKEVERTKNRPIANKNISVHKAIIYACIHGTLSL
LTLFQFNSSTIYTGLYSTFFIFTYPLFKRLTYYAQVYLSLTFNLGYFISASININLINNIIPIIVGFLPLSFLTIIYDTI
YAHQDKKDDIRLKLKSLAIKWDKNTLKYSKVLSLNMLLFLYLSSYLFDMHFSYYIFSTFNIMYLYYILDKVSLNDKQKCM
TFFKKSKNVLFFMVLATILSKASQVVCKNEENNKKKKGNIS

Gene-Specific Links for PFF0370w

General Sub-Cellular Localisation Links