ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFF0360w (UROD)

uroporphyrinogen III decarboxylase, a gene from Plasmodium falciparum

Compiled localisation
apicoplast and not mitochondrion
mitochondrion during intraerythrocytic

Who localised this protein by microscopy?

Nagaraj, V. A., Prasad, D., Arumugam, R., Rangarajan, P. N., Padmanaban, G.
Characterization of coproporphyrinogen III oxidase in Plasmodium falciparum cytosol. (2010 Jun, Parasitol Int) PubMed / full text
   more detail about this publication

mitochondrion during intraerythrocytic
  • "The results presented in Fig. 4 indicate that the PfCPO signal was distributed throughout the parasite, but did not colocalize with that of Mitotracker dye (mitochondrial marker), PfALAS (mitochondrial marker) or PfUROD (apicoplast marker)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: mitochondrial during erythrocytic
  • Comment: strain information not found
  • Other genes localised in this publication: coproporphyrinogen III oxidase, delta-aminolevulinic acid synthetase

Nagaraj, V. A., Arumugam, R., Chandra, N. R., Prasad, D., Rangarajan, P. N., Padmanaban, G.
Localisation of Plasmodium falciparum uroporphyrinogen III decarboxylase of the heme-biosynthetic pathway in the apicoplast and characterisation of its catalytic properties. (2009 Apr, Int J Parasitol) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion
  • "PfUROD was localised to the apicoplast, indicating the requirement of additional mechanisms for transport of the product coproporphyrinogen to other subcellular sites for its further conversion and ultimate heme formation."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: Taken directly from paper, blast from AAZ08395, annotation matches
  • Localisation record: apicoplast and not mitochondria
  • Comment: strain information not found
  • Comment: stage information not found in publication
  • Other genes localised in this publication: porphobilinogen deaminase, heat shock protein 60

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10856

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_010590 uroporphyrinogen III decarboxylase, putative
  • PY02528 uroporphyrinogen decarboxylase, putative
  • PVX_113530 uroporphyrinogen decarboxylase, putative
  • PCHAS_010650 uroporphyrinogen III decarboxylase, putative
  • PKH_114200 uroporphyrinogen decarboxylase, putative
  • TGME49_089940 uroporphyrinogen decarboxylase, putative
  • NCLIV_042300 Uroporphyrinogen decarboxylase (EC 4.1.1.37), related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFF0360w uroporphyrinogen III decarboxylase
MLKCLVTPLLICILTIKILCFINLKKLRFNIIKTETILNMNEVGEIYSRPENLKYEKFGRPQNDLILNVIENKNEEKKFK
KIPLWIMRQAGRYLPEYVEIRKKYDFFEICKSPDLSSYVSIMPYDRFKTDMIVIFSDILIIFVAMGIDIKFVENLGPVFN
LEIYNMNDFNKLNLNMKEIIDNLYYVYDSINLTKKKINNDVPILGFCGSPFTLFMYLTKNNKKTYEDSFKFLYEKPNDAH
QIINKLSDICLNHLINQIDSGANIIQIFDSNAELVDKNIFNEFSIIYLKKVIEIIKKYRPNIYIILFIKNNFHDDIKNLK
IDVLSITHKQLIDNTDQFYFKLFQNNIILQGALDPYILLLNDHELIQKHIIQMMKNITHKNKYIANLGHGILPTTKIKNV
NLFIDTIRNNEWS

Gene-Specific Links for PFF0360w

General Sub-Cellular Localisation Links