ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFF0170w (CHA)

cation/H antiporter, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion during trophozoite

Who localised this protein by microscopy?

Rotmann, A., Sanchez, C., Guiguemde, A., Rohrbach, P., Dave, A., Bakouh, N., Planelles, G., Lanzer, M.
PfCHA is a mitochondrial divalent cation/H+ antiporter in Plasmodium falciparum. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

mitochondrion during trophozoite
  • "In the parasite, PfCHA was found to localize to the mitochondrion."
  • Microscopy type: Live light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication, blast from CAG25205
  • Localisation record: Mitochondria during trophozoite
  • Other genes localised in this publication: citrate synthase, mitochondrial precursor, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11774

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFF0170w cation/H antiporter
MVMGRVRATSYVRRTISQPLNKNVPPMKNMKNVNGLKDTNLIRNRNLHLQLLCNNKMPAGMYDDELTKVYDLEETLPFYY
PRKSDIYGMQNMLNSKLNVLLIFVPIGLLSHFFGFKDIYIFFFNFMVLIPLSALMGHVTEDLALHTGEIIGGLLNATFGN
LMEMIFSIQALNAGLINVVQGTLLGSILSNLLLVLGMSFFAGGLYHHIQKFNEKGATCSTSLLLLSSLAITIPTVSSFTT
NNNLDVILKVSRITAVLIFVTYCLFLLFQLYTHISLFQDKEMTEEIPQLSVISGSIFLILITLLVSIHSEFLIYSIDSVI
KYYNISENFIGVILLPVVGNATEHLTAVTVAMKNKVDLTMGVAVGSSAQIALFVVPVTVLFGWILNKPMTLAFSPLSTVI
LVISVIVTMAIVQDGESNWLEGVLLISAYLIVGVVFWFDTS

Gene-Specific Links for PFF0170w

General Sub-Cellular Localisation Links