ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE1545c (Formin1)

formin 1, putative, a gene from Plasmodium falciparum

Compiled localisation
apical during extracellular merozoite
moving junction during merozoite invasion

Who localised this protein by microscopy?

Baum, J., Tonkin, C. J., Paul, A. S., Rug, M., Smith, B. J., Gould, S. B., Richard, D., Pollard, T. D., Cowman, A. F.
A malaria parasite formin regulates actin polymerization and localizes to the parasite-erythrocyte moving junction during invasion. (2008 Mar 13, Cell Host Microbe) PubMed / full text
   more detail about this publication

apical during extracellular merozoite, moving junction during merozoite invasion
  • "Immunofluorescence microscopy of free merozoites demonstrates that PfFormin1 concentrates at the tip of the parasite "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: apical during free merozoite
  • Other genes localised in this publication: formin 2, putative, rhoptry neck protein 4, formin homology 2 domain-containing protein
  • "Figure 3. Formin 1 Follows the Moving Tight Junction during Merozoite Invasion of the Erythrocyte "
  • Microscopy type: Light
  • Microscopy method: Polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: tight junction during merozoite invasion
  • Other genes localised in this publication: formin 2, putative, rhoptry neck protein 4, formin homology 2 domain-containing protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20714

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFE1545c formin 1, putative
MELNQTIKLATVNDIENDKNIDTLSLLTKMDLKSSNCKHVNCMKMKNINFEDSLRMNDEQIKVKEAVFILQNMENFNYSI
GYSEIQNIRNDLRLFAVNSYHDKKYSDCLIQAIHSYMIAKKYYSKYFGYYLTGDMSTELILICKCFLLVQKIEEGKTYLQ
ELKFLIDNTLLYTHRKGILDNKGLKKEVPSDNTKKNEDKNKNNDNNNNNNNNNTNSSGNNNYEEPVIMCGIQVLANILYI
FADMLSLYKNNDEAENYFLKYLHINEKCYNDDSLNYSDALNDVCSFYIKIREYQKALTLCEKILNIRKLYFGDYNADKPS
EIIADCYCNLGLLYRLTGNVVESLHKYIIAVDMRMRIHKTRHVIQIQDILFSFAIIMHQLNNFKMALQLYKEVYSFYKSY
YGPNDMNTIMTLKLIEELQKDVMNKSGKSIKEQDSSCPIMPNYVKDKIDDTFINNKNEKYHHTNKTHNNNNNNDDDNNNM
WWNTFNEKIKNISNNFNDVHPNLIEQIMNEKVTINTKNPYQNISDKKTFLTLQGKVTYNDLTYSSIDAYKHMQSNKQFQI
IKNSFLNTSSINRIKSLYADSWRNTLIPSTYILPFLETKLVDKNLMKLSECKDFQNAILFKRKILPIVNIPLMERGYVQL
QNDQPIMICNEDAKILLNEWYIKEPFVDSQGKVINKYESLDEQFDMFIPILDQNDDVMLGFYNTPLLVPNPAIHHCILLN
DPSYFDKYNRINNIFPIDSLKFKDNLTDHNKSDITNSESYNSLNHSLSENTDSDSEHSTKKENAPLINNSRENVSSLQNF
KKDTNTPKFSKKFNLKLNDPKKALKLSFSQSSSKQSSEIIKTKSSVISSTPNTSSKISDIRTQNITKTINQNDTPNIIQN
HPSNGTLKSSSPDVSPNSSGTNITSKDNSLSKKITILKGKELTKNKSTNIAKDQDITLKIQNKTDNKTDNQTDNQTNNQT
DNQTDNQTNNQTNNQTNNKIELSKVIEEKNLTLSDIMIGKKTNKDIKNKIPKKKIHVFKLNDNNTSRATSKFSREKYALK
KFSKLNSSFKTSKDKLKLTTNENKSNEADTLEKTNRNLKFKEEPIVKSAMHPNIKMDLRNNMKKLEQYSFVNFKREIYDD
DIPSNNYTNSTIFSHDDEKETVASFNEYNKGTQRKQKKSILSNRSSTVSSLSHVQNYDIIKKKIKINNKNINKNVNTNTS
AHLNGTISDHITYSSSYLSKDDHKNHDTSELKYYKEDRNNIIGITEESIDNNNYDYHYDDEEDDDDINDDIVDIYKLFDS
HSESSYSSVNNYTYRNEKEDNITSLSSQYTIDHVMNKKESKIYKNKYKIFSEIDNVEDDTLDEASYMETNDTYIQSHLKD
TINNIKNVNKEDISFKFTYDENEFLNNDNVLSDNSFASNMINQKMLQNKKEENIIDININHDNLSDPSDFNESMSLKKGK
YKQVNGNLYNNSSKHKLYDLHYDQNNIMLLNNNKIITNETKNIINNNNNIVEEMQLSENEEFFHEMMNVYDSEKYMDIVL
CDNNDSTTKNTTNETSIMYDNKNEKDSHFKNNDNNITHNNNNNDNIFEKYEQPEILLENIFLSSNSIEELDSNLLNNKYK
KNNSNNIYSIKALNKKTDHQSNIEYEDEANNSCISSNINCNTKETNIYHNKDDNNNVNVLRANHNKKNIENINNVLHINS
EKYNTLNHSINTSNFSNPIDSNNHFNEANFDSPQYIDGITNNKNHSHTNNNKKEKKKKSNLSSSYKNTHISKLFTFLSKK
RKNNNNNNTKRNATSLNNVYDEFLNNDISTKERKIYNNNNNNINHININHINSCDNICQLTKPLNDLLFDTKTFDGSNHF
DHTIFDKHDNINIKKNKKTHLFITQSSHGMEKPKLLNMKGKTFTLKKLIGIKKNLGPKKQPPMQNKELTKNANMNQPEEP
NDNSAKDDTPNENQNHEEIINNNQEENKQIELSNDKENQNQNQNENQNKRISLINNVQNNSEDITKKNISEKMQLKVIPK
KSMNVVKHSTLDKMNEDSKNNNLLKRNNSALNKDVPYAKNINDKLSFNLLKDVKFCKIGYEKDDSMGTLPVVHLLNENKK
VIAIVPWQIDLTSFALAKSSIDEEQIRKIGLMYREIDIPLEDRQKQIQVEKNLLLGEGLKELGLGRGGTPGVSSGMGVAV
DSGSINLISGIDLNALKESYKIEKKIEVKEEKKESAPKKDTPKSKGAPKGGKGGKKGPPAFMKGPPKNVKGALAVGKTKF
SKLTKAKDEGKTKRFFWEALFENDIPGTLFEDKKEFITKIAIEKENVEKSFAKAVSKKDNEKETKIKKPKVIQLLPDSKR
EYNMSIALSKFNNYTFKEIRDAIMELNPKILNIDNTEVLLQYVPTPEEFEIVKEYIHSNGDLNLVDKPEQYVAAIIGVPL
LKQRLESHYYALSFKENYENTLNPLENILEACEAIKDSNKLFTILFTILNVGNTLNYGDAQRGNAFGFKLSTLSKLNDIR
SSTKPVKTLLQYICEVIFEKSKETLSIIDELRCIEKSIKTDKQTIDAFLQKLKLGCNKIKTVLEQAKKTPTDPLCEALTE
FYYSVEPKIVELENFYNQTFAAFKDIALYLGYKEKDINTIQVQDFFKELWTFIQAVEFNRKTINEALLKQLKKQEKELAN
EKQGTVLKKKQNFTITKKQDNEQKDKIEKKTFKIF

Gene-Specific Links for PFE1545c

General Sub-Cellular Localisation Links