ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE1510c (iTPT)

triose phosphate transporter, a gene from Plasmodium falciparum

Compiled localisation
innermost apicoplast membrane during intraerythrocytic

Who localised this protein by microscopy?

Mullin, K. A., Lim, L., Ralph, S. A., Spurck, T. P., Handman, E., McFadden, G. I.
Membrane transporters in the relict plastid of malaria parasites. (2006 Jun 20, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

innermost apicoplast membrane during intraerythrocytic
  • "PfiTPT Is Targeted to the Innermost Apicoplast Membrane."
  • Microscopy type: Light, EM
  • Microscopy method: C terminal HA tag, N terminal HA tag, YFP tag, antibody to epitope RNQPELFYDEQELKRINS
  • Strain:
  • Gene model mapping comments: Taken directly from paper
  • Localisation record: Innermost apicoplast membrane during asexual
  • Other genes localised in this publication: triose phosphate transporter, acyl carrier protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_33670

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_124460 triose phosphate transporter, putative
  • PY01812 phophate translocator
  • PVX_079755 phosphoenolpyruvate/phosphate translocator precursor, putative
  • PCHAS_124500 triose phosphate transporter, putative
  • PKH_100180 phosphoenolpyruvate/phosphate translocator precursor, putative
  • TP01_0715 phosphate/phosphoenolpyruvate translocator, putative
  • TA06475 sugar transporter, putative
  • BBOV_IV009970 triose phosphate/phosphate translocator, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFE1510c triose phosphate transporter
MNVLTRTLIITIFFNLQIYIGKCLNHDNIKNIKNVPMNFHLKNTNGKIYQKNKRPSQINRKNTNKQAFNIPVFSIPNYKP
KYNTCTKTKNIAFVNSRINQAHNRNIQVTKAAELNAIKKIKNDKKFTLFNSGNRDNIKTYEHDINKGIIDDISTTNNSYS
NIGDTSENTYQPNNFNNTLTEKKPCTFLNKAVEVGKTVSLLGMWYVCNIFYNIENKKALNILNMPITIAITQIYVGLPIF
LIPWLLKLRNQPELFYDEQELKRINMSDRNALIKGFQKYVLFLKKYSSIMKQSIYHGYAHLLSVIAMGAGAISFVHIVKA
SAPLFAAFFSYFFMNNKMSIYTYSSLVPIVFGVSLASIKELSFTYKALYSTLSANVLSTMRAIEAKIMMGKNLDKLGRNL
TPENIFALLTLSSAIFLTPALYIDSHKWKDAYEYLMNNKNVLKVLGRHVLMSGVWFYLYNQLSFISLNRLNHITHAVAST
VKRVFLILTSYFIFGTKFSFLGGLGSSIAVGGTFVYSLVKKKFG

Gene-Specific Links for PFE1510c

General Sub-Cellular Localisation Links