PFE1290w (Nek2) *
* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.
NIMA related kinase 2, a
gene from Plasmodium falciparum
Compiled localisation
microtubule during female gametocyte
Who localised this protein by microscopy?
Reininger, L., Tewari, R., Fennell, C., Holland, Z., Goldring, D., Ranford-Cartwright, L., Billker, O., Doerig, C. An essential role for the Plasmodium Nek-2 Nima-related protein kinase in the sexual development of malaria parasites. (2009 Jul 31, J Biol Chem)
PubMed /
full text
   more detail about this publication
microtubule during female gametocyte
-
"The green fluorescence appears to be associated with tubular structures that might be the microtubules spanning the length of the gametocyte. This would be in line with the association of Neks with microtubules and microtubule-organising centers (MTOCs) in plants (25) and mammals (reviewed in (6))."
-
Microscopy type: Light
-
Microscopy method: C terminal GFP tag
-
Strain: 3D7
-
Gene model mapping comments: Taken directly from publication, gene model inconsistent Pfnek-2 ORF comprises eight exons, a gene structure that differs from all gene predictions proposed in PlasmoDB: exons 1 and 2 follow the Glimmer prediction, while exons 3 - 8 are as proposed by the Pf annotation.
-
Localisation record: microtubule during female gametocyte
- Other genes localised in this publication:
osmiophilic body protein
Orthology
OrthoMCL
Part of OrthoMCL group OG4_10564
Localised Genes in this Group
Other Apicomplexan Genes in this Group
-
MAL7P1.100 NIMA related kinase 4
-
PBANKA_061670 NIMA related kinase 4
-
PBANKA_124070 NIMA related kinase 2
-
PY02456 hypothetical protein
-
PY06724 Protein kinase domain
-
PVX_079950 serine/threonine-protein kinase Nek1, putative
-
PVX_096360 serine/threonine-protein kinase NEK4, putative
-
PCHAS_061840 NIMA related kinase 4, putative
-
PCHAS_124110 NIMA related kinase 2, putative
-
PKH_031300 serine/threonine-protein kinase 2, putative
-
PKH_100620 serine/threonine-protein kinase Nek1, putative
-
TGME49_018400 NEK kinase
-
TGME49_044620 NEK kinase
-
TGME49_066710 NEK kinase
-
TGME49_119700 NEK kinase
-
NCLIV_001010 hypothetical protein
-
NCLIV_001140 CMGC kinase, CK2 family, putative
-
NCLIV_019170 hypothetical protein
-
NCLIV_039330 NEK kinase, putative
-
NCLIV_061840 hypothetical protein
-
cgd7_3760 hypothetical protein
-
Chro.70419 hypothetical protein
-
CMU_013820 protein kinase domain-containing protein
-
TA06530 protein kinase, putative
-
BBOV_IV008300 protein kinase domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
Amino Acid Sequence
>PFE1290w NIMA related kinase 2
MSKPKMIGPYEVVKSIGRGSFGIVTAVKDENEKIFVIKELDISCMNNKEKMNVVNEIRALIKMSVHPFIVRYKEAFVEDC VLYVAMDYCINGDLGKVIKKHKELETPIPEKKIKRWLLQIIMAIKFIHDKKLIHRDLKCNNIFLDEKERAKIGDFGLAKF IEQTEQTNTLCGTIGYMAPEICKNINYSFPADIWSLGIILYELISLKPPFKSNNSNMLSVAQKICEDEPDPLPDSFSKDL INLCYWMLKKDWKDRPTIYDIISTDYIQDELQLFKREMLQERNSQI
Proteomics
Found in:
Not found in:
Gene-Specific Links for PFE1290w
General Sub-Cellular Localisation Links
-
PlasmoDB:
-
Malaria Parasite Metabolic Pathways
-
MalSig, prediction of P. falciparum
signal peptides
-
PSEApred, prediction of P. falciparum
proteins secreted into the infected erythrocyte
-
PlasMit, prediction of P. falciparum
mitochondrial transit peptides
-
P. falciparum
apicoplast leader predictors:
-
PlasmoDraft, predictions of P. falciparum gene function based on postgenomic data
-
TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
-
OrthoMCL, automatic clustering of orthologous groups of proteins
|