ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE1290w (Nek2) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

NIMA related kinase 2, a gene from Plasmodium falciparum

Compiled localisation
microtubule during female gametocyte

Who localised this protein by microscopy?

Reininger, L., Tewari, R., Fennell, C., Holland, Z., Goldring, D., Ranford-Cartwright, L., Billker, O., Doerig, C.
An essential role for the Plasmodium Nek-2 Nima-related protein kinase in the sexual development of malaria parasites. (2009 Jul 31, J Biol Chem) PubMed / full text
   more detail about this publication

microtubule during female gametocyte
  • "The green fluorescence appears to be associated with tubular structures that might be the microtubules spanning the length of the gametocyte. This would be in line with the association of Neks with microtubules and microtubule-organising centers (MTOCs) in plants (25) and mammals (reviewed in (6))."
  • Microscopy type: Light
  • Microscopy method: C terminal GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication, gene model inconsistent Pfnek-2 ORF comprises eight exons, a gene structure that differs from all gene predictions proposed in PlasmoDB: exons 1 and 2 follow the Glimmer prediction, while exons 3 - 8 are as proposed by the Pf annotation.
  • Localisation record: microtubule during female gametocyte
  • Other genes localised in this publication: osmiophilic body protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10564

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFE1290w NIMA related kinase 2
MSKPKMIGPYEVVKSIGRGSFGIVTAVKDENEKIFVIKELDISCMNNKEKMNVVNEIRALIKMSVHPFIVRYKEAFVEDC
VLYVAMDYCINGDLGKVIKKHKELETPIPEKKIKRWLLQIIMAIKFIHDKKLIHRDLKCNNIFLDEKERAKIGDFGLAKF
IEQTEQTNTLCGTIGYMAPEICKNINYSFPADIWSLGIILYELISLKPPFKSNNSNMLSVAQKICEDEPDPLPDSFSKDL
INLCYWMLKKDWKDRPTIYDIISTDYIQDELQLFKREMLQERNSQI

Gene-Specific Links for PFE1290w

General Sub-Cellular Localisation Links