ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE1285w ()

membrane skeletal protein IMC1-related, a gene from Plasmodium falciparum

Compiled localisation
inner membrane complex during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

inner membrane complex during extracellular merozoite and late schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_26690

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFE1285w membrane skeletal protein IMC1-related
MCSTNKNLACCKGDNVFDGQINGNESYPQVVNKQLPPKVLEPIIQNKIVEIPKEVYLEKIVEVPQIKTVERIVEQIRPVI
KYKNVYKPKIVYVEKVKNVDKIIYQEKIVEVPQIKTVEKIVEVPVYVNRERIITVPRYMVVEKVIPVLKTSKRESIMEVP
EVNCPHIDISKEVEDKEEIPINELKENQTISLADEKEIQILNDLTSQKVDSNATINMEGEQDTTVDTITQENFCGTVSCN
FLPNYPNFSKIGNPLCKGGPEKEKRFSSISIYKSKDSGFPSIRIAKTPQMFQRNLYCSYA

Gene-Specific Links for PFE1285w

General Sub-Cellular Localisation Links