ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE1230c (Tom22)

mitochondrial import receptor subunit tom22, putative, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion

Who localised this protein by microscopy?

van Dooren, G. G., Stimmler, L. M., McFadden, G. I.
Metabolic maps and functions of the Plasmodium mitochondrion. (2006 Jul, FEMS Microbiol Rev) PubMed / full text
   more detail about this publication

mitochondrion

Orthology

OrthoMCL

Part of OrthoMCL group OG4_25887

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFE1230c mitochondrial import receptor subunit tom22, putative
MGTALSKIITINEENRLVISNKPVFQLAHKDAIRMRNKLRVAKNRINNFLKKSIKTTSWVVWIAGVSVVVLVTPIAFQYE
KECQLFEMQAQFFQAQQAANVPQLN

Gene-Specific Links for PFE1230c

General Sub-Cellular Localisation Links