ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE1195w (Kb)

karyopherin beta, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm and nucleus during ring and trophozoite
parasitophorous vacuole during schizont

Who localised this protein by microscopy?

Mohmmed, A., Kishore, S., Patra, K. P., Dasaradhi, P. V., Malhotra, P., Chauhan, V. S.
Identification of karyopherin beta as an immunogenic antigen of the malaria parasite using immune mice and human sera. (2005 May, Parasite Immunol) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during ring and trophozoite, parasitophorous vacuole during schizont
  • "Results of IFA showed that the protein was localized in the cytoplasm at the ring and trophozoite stages (Figure2a,b), whereas at the schizont stage it was mostly localized in the parasitophorous vacuole (Figure2c)."
  • Microscopy type: Light
  • Microscopy method: antibody to homologue
  • Strain: 3D7
  • Gene model mapping comments: Blast from AF539437, annotation matches
  • Localisation record: cytoplasm and nucleus during ring and troph, PV during schizont
  • Other genes localised in this publication: merozoite surface protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11020

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFE1195w karyopherin beta
MDKIVEVIEGLSSSESHIRNECENTLNYYKKNDLNNTVLSILKLLKTHKDSQVRLQCAILIRNIFRVYIKSTHVDVEEKE
KNENSIGNAEEENYWVLLPDNLKNIVKSELISNIGTETDKMVRSNICNNIIDLSSKLLLHNQWPELLSVTFEFCNSNNVD
VLISGYKILGGILSCIPDELDGKQEIISSICMKGLNSSNVQVRGECINLISCIVEDNSSSLVKSVHGCIPLILQSLSLMA
KNSSSDIAVLEECEKVLQSIGKMIDYNAKFFTKHITSLCDILFSICMKDENELNYDFDNSLKSLSIEALVTIPERRPKMA
LSVPHFVDKIIHLSMLFMLDINNDCFNEWMNSIKEGKDDSQELYDIGEESLDRVGKAFSELEEAEFIHILFNKVSEFLMK
NTWEHKYVGIMAIAQTIEYLPEDEIEEQLEHVIKMLLQILVDQDVRVRYAACQAIGQISLDHQPYVQKEFFSEILSALIN
TMNDVHLRVQSHATAAFVNYAEELDKMALLPYADIIIDILLQKLNSSNYLLVREQAVTAIAVIAGVIEEDFLKYYSTVVP
MMKDIIQKAVSEEERTCRGKAIECISIIGLSVGKDIFIEDAKECMNALLQISSTKMDPDDTVKEYIQEAIGRICRALGND
FYPYLSSIVPTILSVLSVLPKPLTDDEEDLTITMVSNGQYVGLKTSLLEDQEKALDLLIIIIEVLKENYKDYIQATATAV
LPMLNYELSDEIKQKALTAVSELIESARILSEKTDNDKSMLLAILTAAAEKVLKSLLETKLDDNYEYILDVMIIESHGLY
MCLQKAGSNVLPENTLKLFFNQIFALLQYSTDRRVVYNQKKNNDDVDEDELLIIDREEELEQNYRTNLLDILGVLIKYHP
TQFLNTCCELCIGFINNYMNSPNSEDVALALYVCDDLLEFLQEKSVNLWDFFMNPLLLNINHADDKVKQAACYGVIQATK
IEAFGKYANIAVEYLLKLVHESTSNKKPKEYISAIDNAIAALGDVVLMHTSKFNNAEDLIKVWLNHLPIKEDDAEGRRVH
KNLIDLVSQNHPLLFGKDNSNTAKIIEIFLTIYETDFSDTDCNKKISTLINSLDKSYLNNLASSTLSHKQAKKLNNILNP
NRK

Gene-Specific Links for PFE1195w

General Sub-Cellular Localisation Links