ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0830c (MB2)

sporozoite surface antigen MB2, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during hepatocyte sporozoite and salivary gland sporozoite
cytoplasm and nucleus during gametocyte and intraerythrocytic
parasitophorous vacuole during gametocyte

Who localised this protein by microscopy?

Nguyen, T. V., Fujioka, H., Kang, A. S., Rogers, W. O., Fidock, D. A., James, A. A.
Stage-dependent localization of a novel gene product of the malaria parasite, Plasmodium falciparum. (2001 Jul 13, J Biol Chem) PubMed / full text
   more detail about this publication

parasite plasma membrane during hepatocyte sporozoite and salivary gland sporozoite, cytoplasm and nucleus during gametocyte and intraerythrocytic, parasitophorous vacuole during gametocyte
  • "All rabbit antisera prepared against recombinant peptides derived from the B and A domains (Fig. 2A), and reacted with sectioned material containing sporozoites, showed that MB2 protein was localized predominantly to the surface (Fig. 3, A-D). In contrast, the majority of the MB2 protein detected in blood-stage parasites using both antisera against the B domain was localized in the nucleus, with some antibody reactivity detected in the cytoplasm (Fig. 3, E and F) and data not shown). MB2 protein was detected in the cytoplasm, nucleus, and parasitophorous vacuole (PV) space of gametocyte-stage parasites using the anti-B domain antiserum (Fig. 3H)."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54
  • Gene model mapping comments: Blast from AF378133
  • Localisation record: surface during salivary gland sporozoite and liver stage sporozoite, mainly nucleus and some cytoplasm during asexual, cytoplasm and nucleus and PV during gametocyte
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10585

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF08_0018 translation initiation factor-like protein
  • PBANKA_070360 translation initiation factor-like protein
  • PBANKA_123140 sporozoite surface antigen MB2
  • PY03311 Plasmodium falciparum MB2
  • PY06191 translation initiation factor IF-2
  • PVX_080420 MB2 protein, putative
  • PVX_089010 translation initiation factor IF-2, putative
  • PCHAS_093440 translation initiation factor-like protein
  • PCHAS_123200 sporozoite surface antigen MB2, putative
  • PKH_050380 translation intiation factor IF-2
  • PKH_101620 MB2 protein, putative
  • TGME49_078550 elongation factor Tu GTP-binding domain-containing protein
  • NCLIV_067450 hypothetical protein
  • TA03280 translation initiation factor, putative
  • TA07605 GTPase-activity protein, or translation initiation factor IF-2 mitochondrial precursor, putative
  • BBOV_I003420 elongation factor Tu GTP binding domain containing protein
  • BBOV_II003130 elongation factor Tu GTP binding domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFE0830c sporozoite surface antigen MB2
MFLIWRLYKTLFLILYIIILQEYVCHSSNHIKSVNRCFIPFISEYIYKQKNRKNNISYDSSNSHYNDKIIPCGNYNKQLK
YKINFCRNLYFNNKNEYNRICSRNKLNFHNIQTDNTIYKPKKKYYEVGKVREKIKMYTLFKDDKINTLKCNEEESVTSET
INKHDSSVKVKGRRKKNITSNENIMNPNNKSVSSINTNLSDSSNNKNDNSLNSKKNDNTLNSKKNDNTLNSKKNDNTLNS
KNNNNSLNSKNNNNSLNSKKSNNSYNDKHIDHIIPEGKNKINNNIDVKHNINNKLNEINEEPYEDTHNKEENSSNKNDND
EKRKEENNNITRRYIKNDQMSYNNINTNSNEYDKNASTLDETYIGKTFEGYVYSVNKNAACIKLKNINKYGLLFKNKANL
GDDIEDMNDFFEKDQPVHVKILGINTKKNIFYLGNIIKYNENIKLSKGEYSKGLITKVCDSYCFIKVLKNGSTGYLHKSK
LFCMNDKEKKNNDNQNYDNPNNDNPNYDNQNYDNQNYNNPNYDHPNYDNQNYDNQNYNNPNNDYSTSQLYNSDNLQMDFI
YKLQFTKIFNIWDIIDVEILGTPQNDYKSNYILTIPRGSKTFKKILNYLNVLKENEDINNIQYKGDYIYSIDNNKNDNII
DSDINNHHINNKKKKKNLYDIQNNMNHSPFNKFHTEDEYLFNDHVQENVHTFYEKNKKYKITYDKENNHKMNKSYYLKKN
KELPFNNKFKKIIKNIYDLPNTISLSMLSKTIKIPLASIKKYFIIHENKEYNSSYKINSEQIKRICQHFKIDCNVEQRDD
NVVTKVNGTTKDCQEKVFKNVTQDRLKEGEQERVIKVEAKIKNDEMVMQEQKDTKEEKHMDVQFIEEKDINVQHINVQDM
DVQDMDVQDINVQDMDVQNINVQDINIQDMDVQNINNSITLNKSTSCQTDESRDAPGGDQNESLDEKDSMEKSKEKKKKK
GKSRKKNKDTNLTLKSDSIQKSKTTLDDKKRNVVVTFIGHINHGKTSLFDYICKTNEQKKEYGLITQNIRAFKATVRNNF
TFTLVDTPGHEAFMPMRSRGVKISDLSILVISGDEGIQEQTVECIKLIKEFNIKIIIAITKVDIPNVDVDRIINDLLYHD
ITTELNGGEIQVVECSIYKEESIDKLLDAIYLESEFLNLQTNPDKKHEQAQGVVLDSYIDKNGIVSINLLQNGVLNINDH
FYTGSSYGKVKILKDHLNKNIKSAYPSDPIKIIGYNKNSVPVAGDKFYVVENEALAKEIAEHNKNKMLTMEINNFTYDQT
NMNRYKDFIISRENKIGGSSGILGENNLKNDIDGNMTRDDNMTRDDNMTSDDNMTRDGNRTNNDNITSDDNMSNDYDKIK
ETKMYTNNKSFQKDDFLKIHLNNTNENVINMDPSTHIGKNEIKTIYSNYIIKCDKQGSIEVLKNCMLKLQKEDSICKIKN
KIIYADIGNVTSSDIKYATSFNATIIAFGVKLSNDIKGSKNSKGSKNHNNYPIIYSNVLYELIENVEKEMEKKLSKKPMG
ELKGTAQILKVFNISKLGKVAGCIVKKGTISINSNIRILRNDKVIYMGKIISIKIVKEEKTQVTEADECGIGFDNFLDFE
PNDIIEAYEN

Gene-Specific Links for PFE0830c

General Sub-Cellular Localisation Links