ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0765w (PI3K)

phosphatidylinositol 3-kinase, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte and food vacuole and periphery during late trophozoite

Who localised this protein by microscopy?

Vaid, A., Ranjan, R., Smythe, W. A., Hoppe, H. C., Sharma, P.
PfPI3K, a phosphatidylinositol-3 kinase from Plasmodium falciparum, is exported to the host erythrocyte and is involved in hemoglobin trafficking. (2010 Mar 25, Blood) PubMed / full text
   more detail about this publication

erythrocyte and food vacuole and periphery during late trophozoite
  • "Our present studies suggest that PfPI3K, a novel Phosphatidyl-inositol-3-kinase (PI3K) in Plasmodium falciparum, is exported to the host erythrocyte by the parasite in an active form. PfPI3K is a versatile enzyme as it can generate various 3’-phosphorylated PIPs. In the parasite, PfPI3K was localized in vesicular compartments near the membrane and in its food vacuole. "
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein helival domain
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: food vacuole and near parasite membrane and host erythrocyte during mature trophozoite
  • Comment: stage information not found in publication
  • Other genes localised in this publication: conserved Plasmodium protein, unknown function

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11558

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_111490 phosphatidylinositol 3-kinase, putative
  • PY00334 phosphatidylinositol 3-kinase vps34-like
  • PVX_080480 phosphatidylinositol 3-kinase, putative
  • PCHAS_111450 phosphatidylinositol 3-kinase, putative
  • PKH_101740 phosphatidylinositol 3-kinase, putative
  • TGME49_015700 phosphatidylinositol 3-kinase, putative
  • NCLIV_052580 phosphatidylinositol 3-kinase, putative
  • cgd6_1760 phosphatidylinositol 3-kinase; PI3ka plus PI3Kc domains
  • Chro.60213 phosphatidylinositol 3-kinase, root isoform
  • CMU_008130 phosphatidylinositol 3- and 4-kinase family protein
  • BBOV_I002970 phosphatidylinositol 3- and 4-kinase domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFE0765w phosphatidylinositol 3-kinase
MKIRYDKCSSTKDLNYFFHLKLGFFVCYKNHNDKYSFKNKILQKNDTILFFKKKKKFMYLRKKKKKKKKKILIQIIQEYN
KYNEYFKYNSNLEGNQGFNKKPEKNKNTKGNVYTDHTNQNAKSKIYNYDMNDDSYSNYVNNNNVFRISSFLILNNEFFGY
PLQFVCETEGRSRNHEHYPDVHGDNIKYNKCDDNKYNKCDDNKYDKCDDNKYNKCDDNKYDTCDDNKYDTCDDNKYDTCD
DNKYNKYDDDKYDTCDDNKYNKYDDDKYNKYDDDKYNKYDDDKYEKSRKKKKLNNLYKTILTKKKRKKMNSNLCVINKIY
KYPIKYCELNSKAFVFFIIKNVGVHKITYYSYNKLFSKDGVLNQGIQICKLYHVNKNKKIKQIIFEALKNKITFSYDNNP
NNIKKKIYKFLKKNCAYHDLIKLFYFKGHKQREKCNKKLNMEKTFGVHKSSRYNYKTYKKKKKIDMCKNYCDDILDTYNS
KYYKGELSGQHKHIKMTGEQKEEHHIKYTHLNFNHGKDETFYKELYKCNYIEKYISSVNYFLLERRRMFNKYKQQELCVN
KNEENNKNKNDDDNKNDDDNKNDDDNNKNDDDNKNDDDDNKNDDDNKNDDDDNKNDDDDNNKNNIQCDNHSDNIYMCGTY
GNMENYNVPHSTNNTNLQSIKKRIINMNILDNIRCNKTYKYIDKNKFKCFTYYSCKNYNVCKKIIEKYKLYKFLKKKKIE
GYMILNFLNFNKELIYYNEHKKDMSTLHDNLFDVISNNQNENVKYNHICNNNKYDWFFNSFDYVGNLEESITCFNNHKKK
ENMKNIKNIKKKKKKNLFYNEQHNIKNNKNDYHFDKYPSSLYSHLTNKKMVNNTEVNNIKDENSLQMYIINKDVTKNKDG
NLLLNSYYNSKLGKSINTCSKEIYKEEHKNVYIYNKKITKMNIKMKTEQKYICVDSKRNTRTYNSKNIRTYNSKNIRTYN
SKNIRTYNRKNIRTYNRKNIRTYNRKNIRTYNRKNIRCNNRKKFHLNRNKKKNGCVKKYKLYDERNTLVYKNKIGSNHFF
LKEEIGKSTKKLNDIFEHISNYTNRISKNINITNKNRYDDYPFDFLSKDKIEYISMLSPTINEIKTLNTILTIPLIKMNE
YEKNCIWRFRFQLLNRKETLGKFLKSINWNNKEEEEEAIILLNKWAKPGIENCIELFYSHLHHYVIKKYIIDIIKNSKKE
EIKLYLFQLVQSLRTFNYQHIDNLFINTLIQKCIKSKKLSIYFYWFLLSEAKDKIKGKLYLHIHKLFINKLMTSNIRKNK
IILDILKNQNRFRNQLLYLTKIAKNKTDRIQNKTRKLRNFLFYYRTNYGYINIKDFIKNNIFISDHNVYDFLDICKMKRE
NSLDTPMRGDNIGQPSYLGMVPGMGKSTDDSKNVYGDDNKNVYGDDNKNVYGDDSKNIYCDDNKNVYGDDNKNIYGDDSK
NIYGDDNKNIFSDDNKNLYSDNNNNKHIRYNKYVKNISYEHFNEYPYDNKKSRNIYTCNKDICNSIYYLDNELTINYDIK
DDLYFFQYKRSSDEKLLNTDLSNDSNDMIHYIDDSKNVKIERNRDNSFFSNFLQFNDNLDFFLNATYSDEDNNYEILDDS
INFVQKQKIKKIKTPLILPIDPNIELLSFLPEQSYVLRSSLYPIVIACLVRKKIKLYNENYNNLIINNHTFYKNDQNKDN
IINNLSYDKSYHSYYNSQFIKTLQNSFESTTSLNYHYNFLKCSNNNIFYKNKKIERIKPNTSIQKAFPSNENILNRNQHV
YYSNNQIVHNIKKMNKHKRDDYMINEKVLPCVSNSCLGDKLMPSHDKMRSSHDKMMPSHDKMMPSHDKLMSPHYTLMSSH
DKPVAPSGVSSLGEKKSKDEKKNRKKYNEIYQLSIKKYIYKAGDDLRQDHLVIQIIYVMDNIWKRYGLDLKMTLYRVLAL
STDDGFIEFVDYAESISSIKKNYKGEIRQYFIDNSTCSSSPLGFDTEILQNFISSCAGYSVITYILGIGDRHLDNLMVTK
DGRFFHIDFGYIFGEDPKPFSPPMKLCKEMIEAMGGAHSIGYEQFLKKCCLAYKYLRYHSQLIISLLDAMCDAGLKDMKM
SPELCVLKVQEKFRLDLNDEAAEIYFLSVINASVKTLFPVVVDKLHEWALNWK

Gene-Specific Links for PFE0765w

General Sub-Cellular Localisation Links