ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0610c (MAT1)

CDK-activating kinase assembly factor, a gene from Plasmodium falciparum

Compiled localisation
nucleus during schizont

Who localised this protein by microscopy?

Jirage, D., Chen, Y., Caridha, D., O'Neil, M. T., Eyase, F., Witola, W. H., Mamoun, C. B., Waters, N. C.
The malarial CDK Pfmrk and its effector PfMAT1 phosphorylate DNA replication proteins and co-localize in the nucleus. (2010 Jul, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

nucleus during schizont
  • "Immunofluorescence analyses using GFP and RFP tagged versions of Pfmrk and PfMAT1, respectively, demonstrated the co-localization of these two proteins to the parasite nucleus."
  • Microscopy type: Live light
  • Microscopy method: RFP tag
  • Strain: W2
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: nucleus during schizont
  • Other genes localised in this publication: MO15-related protein kinase

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12471

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFE0610c CDK-activating kinase assembly factor
MDEYKCISCFEDIYVNNEKKLYFFDICKHKICGECLENHLNKLNKQYCPLCKVSVTKKNVSLFDIEERIYANQKNVRSKL
TEIFNKRRHNFENTPLYNNYLEKVEDMIYVLTNECDEKKRKIIEAYIKKYEKDNYKLIEENNALIYQNERKKIHEIVKEE
GNLYEIIKHRPIINKVHNETYVHSLIKENPKFFDEVKVANIVEVQPQPLNPAYKNDTDIPLRKYFSQDELYQADYAGGYD
TNVVLKRCDIEFNKTIYYNI

Gene-Specific Links for PFE0610c

General Sub-Cellular Localisation Links