ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0545c (TCTP)

translationally controlled tumor protein homolog, putative, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm and food vacuole membrane and parasite plasma membrane

Who localised this protein by microscopy?

Bhisutthibhan, J., Philbert, M. A., Fujioka, H., Aikawa, M., Meshnick, S. R.
The Plasmodium falciparum translationally controlled tumor protein: subcellular localization and calcium binding. (1999 Sep, Eur J Cell Biol) PubMed / full text
   more detail about this publication

cytoplasm and food vacuole membrane and parasite plasma membrane
  • "Immunoelectron microscopy shows that it is present in the parasite cytoplasm as well as in its food vacuolar and limiting membranes."
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: Blast from GSS 2040787 mentioned in 9632675
  • Localisation record: Cytoplasm, FV membrane, limiting membranes
  • Comment: Unable to find full text online
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11073

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_111050 translationally controlled tumor protein homolog, putative
  • PY04896 translationally controlled tumor protein
  • PVX_080685 translationally controlled tumor protein, putative
  • PCHAS_111020 translationally controlled tumor protein homolog, putative
  • PKH_102200 Translationally-controlled tumor protein homolog (TCTP)
  • TGME49_051680 translationally-controlled tumor protein, putative
  • NCLIV_066760 Translationally-controlled tumor protein, related
  • cgd3_1940 conserved hypothetical protein
  • Chro.30228 histamine-releasing factor
  • CMU_001630 translationally-controlled tumor protein, putative
  • TP01_0276 translationally controlled tumor protein, putative
  • TA21460 p23 (translationally controlled tumor protein homolog), putative
  • BBOV_IV004730 histamine-releasing factor, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFE0545c translationally controlled tumor protein homolog, putative
MKVFKDVFTNDEVCSDSYVQQDPFEVPEFREIAFEVKSNKRIKGNEDYGIADNSEDAVEGMGADVEHVIDIVDSFQLTST
AFSKKEYSAYIKNYMQKVAKYLEEKKPDRVEIFKTKAQPFIKHILTNFDDFEFYMGESLDMEAGIIYSYYKGEEITPRFV
YISDGLFEEKY

Gene-Specific Links for PFE0545c

General Sub-Cellular Localisation Links