ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0410w (oTPT)

triose phosphate transporter, a gene from Plasmodium falciparum

Compiled localisation
outermost apicoplast membrane during intraerythrocytic

Who localised this protein by microscopy?

Mullin, K. A., Lim, L., Ralph, S. A., Spurck, T. P., Handman, E., McFadden, G. I.
Membrane transporters in the relict plastid of malaria parasites. (2006 Jun 20, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

outermost apicoplast membrane during intraerythrocytic
  • "PfoTPT Is Targeted to the Outermost Apicoplast Membrane."
  • Microscopy type: Light, EM
  • Microscopy method: antibody to epitope MKDNEKKNEYGTFPIS
  • Strain:
  • Gene model mapping comments: Taken directly from paper
  • Localisation record: Outermost apicoplast membrane during asexual
  • Other genes localised in this publication: triose phosphate transporter, acyl carrier protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11470

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_110790 triose phosphate transporter, putative
  • PY00389 Arabidopsis thaliana At5g54800/MBG8_6-related
  • PVX_097975 triose/hexose phosphate phosphate translocator, putative
  • PCHAS_110760 triose phosphate transporter, putative
  • PKH_102460 triose or hexose phosphate/phosphate translocator, putative
  • NCLIV_026210 hypothetical protein
  • TA05100 glucose-6-phosphate/phosphate translocator, putative
  • BBOV_I004950 triose or hexose phosphate/phosphate translocator, putative
  • BBOV_I004960 triose phosphate/phosphate translocator, putative
  • BBOV_I004970 triose or hexose phosphate/phosphate translocator, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFE0410w triose phosphate transporter
MKDNEKKNEYGTFPITINEGYSDNVGDNKLKSKGIYHKLFEKLKLALLFLTWYTLNVLYNVDNKKALNMVKLPWFISSMQ
LYVGWIFIFIYWISGMKKIPKIYSYDIFIRNILIQSVCHIFVHFGAVMAMSATSVSFTHVVKACEPVFTAIFSILLLKQY
LKINKYIALLIIVGGVVCASMKELHFTWIAFWCATLSNFGSSIRSIYAKKMMTQKSLIGENLNASNIYAFITIISALISL
PLVLAFEGKETYNFLVNYQGTNYTFKDVIFKIILSGMWYYFNNEVAFMCLERVNQITHALANSIKRVVIIVSSIIIFKTQ
ITLLGAIGSAVAIFGAFLYSIF

Gene-Specific Links for PFE0410w

General Sub-Cellular Localisation Links