ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0395c (Pf38)

6-cysteine protein, a gene from Plasmodium falciparum

Compiled localisation
apical during early schizont and late schizont and merozoite
not parasite plasma membrane during early schizont
merozoite surface during late schizont and merozoite

Who localised this protein by microscopy?

Sanders, P. R., Gilson, P. R., Cantin, G. T., Greenbaum, D. C., Nebl, T., Carucci, D. J., McConville, M. J., Schofield, L., Hodder, A. N., Yates, J. R. 3rd, Crabb, B. S.
Distinct protein classes including novel merozoite surface antigens in Raft-like membranes of Plasmodium falciparum. (2005 Dec 2, J Biol Chem) PubMed / full text
   more detail about this publication

apical during early schizont and late schizont and merozoite, not parasite plasma membrane during early schizont, merozoite surface during late schizont and merozoite
  • "Both Pf12- and Pf38-GFP fusion proteins were localized to the merozoite surface using this approach (Fig. 3A). Interestingly, Pf38-GFP was mostly concentrated in secretory organelles at the apical end of the parasite, exclusively at an early stage of schizont development, suggesting that Pf38 probably predominantly resides in these apical organelles."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from 16203726
  • Localisation record: apical and not surface during early schizont, apical and merozoite surface during late schizont and merozoite
  • Other genes localised in this publication: cysteine-rich surface protein, 6-cysteine protein, 6-cysteine protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48202

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFE0395c 6-cysteine protein
MKRWSIITGIVIIFCILTCKGQVENKKVDFRTEKGKFVPLNLVPGDVVEYSCPYSLNNDIRNMNGVEREHFDNKKFCFDY
IFVGSKLTFLKEYVRGSYNVVHKEEGNLYTSQFSVPPVVLTHRNFDCFCYMEENNVVVKKVLRIHISNGVLRKIPGCDFN
ADYKESTAITTFSNMSPRRVKVCDVYPKSGDFISLMCPSDYSIKPDGCFSNVYVKRYPNEEVKEEDRFNLNRKWDASKYN
VVSIETVLKMNMITQGDKYSIFSKLPDVKDQVDFTCICQSNDEQDNLMMNVYINNTSYLTNNTRSIGVNKHSFSNSEIFE
RIEREEISFAFSSYLSITLILLYLFFLNF

Gene-Specific Links for PFE0395c

General Sub-Cellular Localisation Links