ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0370c (SUB1)

subtilisin-like protease 1, a gene from Plasmodium falciparum

Compiled localisation
exoneme and not dense granule and not microneme and not rhoptry during schizont
during not ring
dense granule during merozoite and schizont

Who localised this protein by microscopy?

Yeoh, S., O'Donnell, R. A., Koussis, K., Dluzewski, A. R., Ansell, K. H., Osborne, S. A., Hackett, F., Withers-Martinez, C., Mitchell, G. H., Bannister, L. H., Bryans, J. S., Kettleborough, C. A., Blackman, M. J.
Subcellular discharge of a serine protease mediates release of invasive malaria parasites from host erythrocytes. (2007 Dec 14, Cell) PubMed / full text
   more detail about this publication

exoneme and not dense granule and not microneme and not rhoptry during schizont, during not ring
  • "Previous studies suggested that PfSUB1 accumulates in subcellular organelles that are distinct from micronemes and rhoptries (secretory organelles at the apical end of the merozoite involved in invasion) but that resemble a third class of secretory vesicles called dense granules (Blackman etal., 1998)."
  • Microscopy type: Light, EM
  • Microscopy method: antibody, HA tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Exoneme and not rhoptry and not microneme and not dense granule during schizont, not during ring
  • Other genes localised in this publication: high molecular weight rhoptry protein 2, apical membrane antigen 1, ring-infected erythrocyte surface antigen, merozoite surface protein 1

Blackman, M. J., Fujioka, H., Stafford, W. H., Sajid, M., Clough, B., Fleck, S. L., Aikawa, M., Grainger, M., Hackett, F.
A subtilisin-like protein in secretory organelles of Plasmodium falciparum merozoites. (1998 Sep 4, J Biol Chem) PubMed / full text
   more detail about this publication

dense granule during merozoite and schizont
  • "The p47 pfsub-1 gene product localizes to dense granules within the apical domain of free P.falciparum merozoites"
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: Blast from AJ002594, annotation matches
  • Localisation record: dense granules during schizont and merozoite
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_18226

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFE0370c subtilisin-like protease 1
MMLNKKVVALCTLTLHLFCIFLCLGKEVRSEENGKIQDDAKKIVSELRFLEKVEDVIEKSNIGGNEVDADENSFNPDTEV
PIEEIEEIKMRELKDVKEEKNKNDNHNNNNNNISSSSSSSSNTFGEEKEEVSKKKKKLRLIVSENHATTPSFFQESLLEP
DVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSADNIDISGIKDAIRRGEENIDVNDY
KSMLEVENDAEDYDKMFGMFNESHAATSKRKRHSTNERGYDTFSSPSYKTYSKSDYLYDDDNNNNNYYYSHSSNGHNSSS
RNSSSSRSRPGKYHFNDEFRNLQWGLDLSRLDETQELINEHQVMSTRICVIDSGIDYNHPDLKDNIELNLKELHGRKGFD
DDNNGIVDDIYGANFVNNSGNPMDDNYHGTHVSGIISAIGNNNIGVVGVDVNSKLIICKALDEHKLGRLGDMFKCLDYCI
SRNAHMINGSFSFDEYSGIFNSSVEYLQRKGILFFVSASNCSHPKSSTPDIRKCDLSINAKYPPILSTVYDNVISVANLK
KNDNNNHYSLSINSFYSNKYCQLAAPGTNIYSTAPHNSYRKLNGTSMAAPHVAAIASLIFSINPDLSYKKVIQILKDSIV
YLPSLKNMVAWAGYADINKAVNLAIKSKKTYINSNISNKWKKKSRYLH

Gene-Specific Links for PFE0370c

General Sub-Cellular Localisation Links