ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0360c ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
parasitophorous vacuole
nucleus during intraerythrocytic

Who localised this protein by microscopy?

Hossain, M. J., Korde, R., Singh, P. K., Kanodia, S., Ranjan, R., Ram, G., Kalsey, G. S., Singh, R., Malhotra, P.
Plasmodium falciparum Tudor Staphylococcal Nuclease interacting proteins suggest its role in nuclear as well as splicing processes. (2010 Nov 15, Gene) PubMed / full text
   more detail about this publication

nucleus during intraerythrocytic

Sargeant, T. J., Marti, M., Caler, E., Carlton, J. M., Simpson, K., Speed, T. P., Cowman, A. F.
Lineage-specific expansion of proteins exported to erythrocytes in malaria parasites. (2006, Genome Biol) PubMed / full text
   more detail about this publication

parasitophorous vacuole

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48397

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFE0360c conserved Plasmodium protein, unknown function
MIYLGKKLLSCTLFVYFLYIHFFLLKQNNFCDVKVRERILEESINNDLSSKGENLHIYEKTNVSVQTFIKKKERKNLSDN
NINDKINNNNNYNNNNNNNIEDTTYYPTGNEKKENIFLKIFRYVKNWFPIKSSNNLKKTNINYEQVQEENEFSKYILQNN
MSIETTKVCLIGSGGDSSHDLIKQFLLHNNVKYNRNYENDNSLNNKSGSIISSYKYYSEEIIQEPYIIDRDICNKKKNCK
ESTLNYENNPKTLIGNIIIQSDILKNEKIFNMNRHFVVCKYFGSIPKTNIKINQSTLIQHLIKCLDYCKMEGVQYIYIGY
NIYAANNKLIEIMKKLREHKIIIVTSSGKIYDDDNNNDNNNFYNDNIYNNNIYNVHNDDKEKIKNHIKKKNKQNNYLYEY
QRTQKDEEQKSNSSLYQNLENVISISGLIYTDSSKKNKNKNYIYDNEIKILDQKGNKKLNRNYISLFYFSYDTDIYEKIE
SDIIDDDHDLVSASFVNTLVLMHSINLKLSLGRLRKILNKSIVKREELRHLSNRAYYHDMMNTFEDSLNQRKRSYKIFYL
ELKNNKHKVLLSDANLKSMYQDNLPVNYNEEDHVKHNVEQETSVERDIYKNNENSNKNRKMDMDEGKGTYIQNKESHKYN
IHYPYNRIKQSLLNDNTLNHKPYVSFLNMSYYNEDIEKRNYNIYDDPSYTYDQGITYDDNYYIDDHDIHTRKKRKISYDG
EDNNDYHMYDDRDNLFHSNLGNNKYEDDGNVHREKEKDLEPRFLYDPFANIENRDLETVQELSELREKKSNNFYSRNHDN
SSNMKRRRKEKKKKLKKVLRSKYDKIGNLERIRRKKKRRMIHKNKINKRRNMKRKNNELEERRNKQADKNSSSGNGKGKI
NGTRNSPKIKFKR

Gene-Specific Links for PFE0360c

General Sub-Cellular Localisation Links