ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0355c ()

subtilisin-like protease 3, putative, a gene from Plasmodium falciparum

Compiled localisation
parasitophorous vacuole

Who localised this protein by microscopy?

Sargeant, T. J., Marti, M., Caler, E., Carlton, J. M., Simpson, K., Speed, T. P., Cowman, A. F.
Lineage-specific expansion of proteins exported to erythrocytes in malaria parasites. (2006, Genome Biol) PubMed / full text
   more detail about this publication

parasitophorous vacuole

Orthology

OrthoMCL

Part of OrthoMCL group OG4_43900

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFE0355c subtilisin-like protease 3, putative
MINRQYFIWYIFIFNIINKIYFENIRYVKNYEVVIRKKKNIERGIGNDFAFIRRYYKSRLLSDVSYKNNSIKGKNRVDKE
GDIKKYDNNDDNKMDNSYDYKNKSIKENETKIRKEQVISLDKRYNRNINEKEEIKKKIKDIQRKRLIIYFKQDNTILSSR
NYKHIFMKVLSSCGHIEKLTFINFYLYEFPKSINNEDMLLKICLRLLESRRINVENDNQISHTVQMKSYNNNNNKWDNIN
SKNNCIYQIKDKIKDLPNVSPSASTFTSISTSPYTLKLRDRNKYANDKNHIFKINHSNKHKNNNNNNNNNDYHNNNKSNY
HSHSSAKCQTQRLNKKMIGTNILDGYDIIQMEEGLNLSHNYELNDVNVCIIDTGIDENHIDLKDNIIEKKTFMKHSYKKY
NIDGINNIESDNIDGINNIESDNIDGINNIESDNIDGINNIESDNIDGINNIESDNIDGINNIKSSDNIKSSDNIKSSDN
INSSDNIKSSDNNNVHTMLRNKLYLKKKKECSNYNTSNDGHGHGTFIAGIIAGNSPKGKKGIKGISKKAKLIICKALNNN
NAGYISDILECFNFCAKKKARIINASFASTTHYPSLFQALKELQDKDILVISSSGNCSSNSKCKQAFQECNLNIQKLYPA
AYSADLNNIISVSNIIQQSNGNIVLSPDSCYSPNYVHLAAPGGNIISTFPNNKYAISSGTSFSASVITGLASLVLSINSN
LTSQQVIELFKKSIVQTKSLENKVKWGGFINVYDLVRFTIDSLPKDKDE

Gene-Specific Links for PFE0355c

General Sub-Cellular Localisation Links