ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0305w (TBP)

transcription initiation factor TFiid, TATA-binding protein, a gene from Plasmodium falciparum

Compiled localisation
nucleus during intraerythrocytic

Who localised this protein by microscopy?

Ruvalcaba-Salazar, O. K., del Carmen Ramirez-Estudillo, M., Montiel-Condado, D., Recillas-Targa, F., Vargas, M., Hernandez-Rivas, R.
Recombinant and native Plasmodium falciparum TATA-binding-protein binds to a specific TATA box element in promoter regions. (2005 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

nucleus during intraerythrocytic
  • "Thus, we generated anti-PfTBP antibodies that specifically recognize P. falciparum TBP, and have shown that PfTBP is located within the nuclei of this parasite."
  • Microscopy type: Light, ChIP
  • Microscopy method: antibody
  • Strain: FCR3
  • Gene model mapping comments: Blast from L06060, annotation matches
  • Localisation record: Nucleus during asexual
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10369

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_110580 transcription initiation factor tfiid, putative
  • PY00712 transcription initiation factor tfiid
  • PVX_097865 transcription initiation factor TFiid, TATA-binding protein, putative
  • PCHAS_110550 transcription initiation factor tfiid, putative
  • PKH_102680 transcription initiation factor TFiid, TATA-binding protein, putative
  • TGME49_058680 TATA-box binding protein, putative
  • NCLIV_027830 TATA-binding protein, related
  • cgd8_2030 TATA-box factor binding protein
  • Chro.80238 TATA-binding protein
  • CMU_026010 TATA-box-binding protein, putative
  • TP01_0630 transcription initiation factor TFIID, putative
  • TA03075 transcription initiation factor (TBP homologue), putative
  • BBOV_IV002970 TATA-box binding protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFE0305w transcription initiation factor TFiid, TATA-binding protein
MHKEEKEKDKKKDNNYDNDYHNDYHNDYHNDYHNDYDNENDCNNNEREGSVHGDNIHAYEEQNYENDILNIINKQMDNIK
SNDPIKNNSNNSYNNNFLDMNFLEQDQLFLENINQDNVVSAHYTSEYDNNEKEKSDDLKNKLVHKNISLNIHNIISSANL
CIDINLRLVAVSIRNAEYNPSKINTLIIRLNKPQCTALIFKNGRIMLTGTRTKKDSIMGCKKIAKIIKIVTKDKVKFCNF
KIENIIASANCNIPIRLEVLAHDHKEYCNYEPELFAGLVYRYKPTSNLKSVILIFVSGKIIITGCKSVNKLYTVFQDIYN
VLIQYKN

Gene-Specific Links for PFE0305w

General Sub-Cellular Localisation Links