ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0160c (SR1)

Ser/Arg-rich splicing factor, putative, a gene from Plasmodium falciparum

Compiled localisation
nucleus during ring and trophozoite
cytoplasm during gametocyte and schizont and trophozoite
not nucleus during gametocyte and schizont

Who localised this protein by microscopy?

Dixit, A., Singh, P. K., Sharma, G. P., Malhotra, P., Sharma, P.
PfSRPK1, a novel splicing-related kinase from Plasmodium falciparum. (2010 Dec 3, J Biol Chem) PubMed / full text
   more detail about this publication

nucleus during ring and trophozoite, cytoplasm during gametocyte and schizont and trophozoite, not nucleus during gametocyte and schizont
  • "These proteins were present predominantly inside the nucleus in the ring stages as indicated by co- localization with nuclear dye DAPI (Fig. 6B). PfSRPK1 and PfSR1 were present in the nucleus of ~75% of rings and young trophozoites that were analyzed. As the parasites matured, PfSRPK1 and PfSR1 seemed to be exported to nuclear periphery and/or cytoplasm in mature trophozoites. Both these proteins were predominantly in the cytoplasm of most (>80%) schizonts. Interestingly, both PfSRPK1 and PfSR1 are present in the cytoplasm of gametocytes with possibly only a small fraction in the nucleus (Fig. 6B). "
  • Microscopy type: Fixed Light
  • Microscopy method: antibody to whole protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Predominantly nucleus during ring, nuclear periphery and cytoplasm during trophozoite, cytoplasm and not nucleus during schizont, cytoplasm and not nucleus during gametocyte
  • Other genes localised in this publication: serine/threonine protein kinase, putative, survival of motor neuron (SMN)-like protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11160

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFE0160c Ser/Arg-rich splicing factor, putative
MGPYINQKNQPMSLLIRKLKFDTSPSIVREKFKRFGAIKDVYLPIDYYTKEPRGFGFVEFYDAKDAEQALKEMNGSEIDG
SRIEVFVAQKGRSDPRHMRYKEKGGYAYRKNPDNKIRRRYISKSNSRYGSYSRDKIRRRERSKERFRYRSSYDRKMSSYR
DRKNYHMKSYDKYRDRNHDRSLSRRSREYRNNTSRYRDKRRYDKYYRSTSRRASRHEKRNENYKSKYNHSNDDYSDETRN
SSKHSRKEHVSRSISFNSEKDDAKKKNDNTSERDNSNDWKGSEQRKEEEDEEVEKEKENEEEEEAIYD

Gene-Specific Links for PFE0160c

General Sub-Cellular Localisation Links