ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0120c (MSP-8) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

merozoite surface protein 8,ring-stage membrane protein 1, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during early ring and extracellular merozoite and late ring and ring and schizont and trophozoite
food vacuole during late ring and late schizont
not parasite plasma membrane during late schizont

Who localised this protein by microscopy?

Drew, D. R., Sanders, P. R., Crabb, B. S.
Plasmodium falciparum merozoite surface protein 8 is a ring-stage membrane protein that localizes to the parasitophorous vacuole of infected erythrocytes. (2005 Jul, Infect Immun) PubMed / full text
   more detail about this publication

parasite plasma membrane during early ring and late ring, food vacuole during late ring and late schizont, not parasite plasma membrane during late schizont
  • "It was apparent that both reagents discontinuously stained the circumference of early-ring-stage parasites and were visualized as discrete dots which showed frequent, but not exclusive, colocalization. This pattern of staining suggests that in early-ring-stage parasites, PfMSP-8 is associated with the parasite plasma membrane and is often in close proximity to PfMSP-119. In contrast, anti-PfMSP-8 antibody staining of late-ring-stage parasites was observed as a smooth rim-like pattern around the circumference of parasites and as a discrete dot adjacent to the nascent hemazoan crystal, which colocalized with PfMSP-119 antibody staining. In contrast, PfMSP-8 staining at this time was limited to the circumference of the large hemazoan crystal, which is consistent with remnant PfMSP-8 protein localizing in the food vacuole. "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Discrete dots on Parasite Plasma Membrane during early ring, smooth circumference and FV during late ring, FV and not circumference during late schizont
  • Other genes localised in this publication: merozoite surface protein 1

Black, C. G., Wu, T., Wang, L., Hibbs, A. R., Coppel, R. L.
Merozoite surface protein 8 of Plasmodium falciparum contains two epidermal growth factor-like domains. (2001 May, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during extracellular merozoite and ring and schizont and trophozoite
  • "The expression of the new protein was localized to the membranes of rings, trophozoites, schizonts and free merozoites."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Blast from AF325161, annotation matches, gene model inconsistent
  • Localisation record: surface during rings and trophs and schizont and free merozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48031

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFE0120c merozoite surface protein 8,ring-stage membrane protein 1
MVFKSSYIFFFLFLVILYFNNVVEGENGTTNIENNPGNNGNMGPSGPKDKDKNIEKDVNHNMSMNNNNNNNNNNNNNDNN
NNINNNNNNNINNNNNNNNNNGNGFSNFFNKLFGKKKDNKKEGEEKNEEDLNSNKNIESNKGSAVTSNVGDTNNDAKARD
NNNNDDNDDNDENDDNDDNDDIDEIDERDDNDDNGDDDDDNDDDDDNNDNNNKNNSNNLTDTKKEGEKIDLGVQNKKQNI
FSTNNKGLNKYNIDNELKEVDALLKNDNYILNKYHVSFFNNFEEDTYNKKKFIRPYDLSLLKSILIYRQRVTRNCVNVFQ
DFNAVFGKCYNKDDTKLSITRDKVKKELSRKNRNFVEYLIEMLENTLNSMNDDFINKDNFDLNNYVKEFELINYLLIHED
SDIFLETYNLISGLNSNIEETSIEKLKYAILQGKQINYKIKDDIYYILKNAYAKYFKIDVYKKGKLLYPTLYYHRNAFIK
SFVVEFFNNNKVCENTKCPLNSNCYVIDDEETCRCLPGFNNIKIDDEMNCVRDDTLDCSRNNGGCDIHAKCSFINKQIVC
ECKDKFEGDGIYCSYSFFSSIHNFIFFFILCLFIFIL

Gene-Specific Links for PFE0120c

General Sub-Cellular Localisation Links