ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0080c (RAP2)

rhoptry-associated protein 2, a gene from Plasmodium falciparum

Compiled localisation
rhoptry bulb
rhoptry during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Singh, S., Plassmeyer, M., Gaur, D., Miller, L. H.
Mononeme: a new secretory organelle in Plasmodium falciparum merozoites identified by localization of rhomboid-1 protease. (2007 Dec 11, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

rhoptry bulb

Bushell, G. R., Ingram, L. T., Fardoulys, C. A., Cooper, J. A.
An antigenic complex in the rhoptries of Plasmodium falciparum. (1988 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during extracellular merozoite and late schizont
  • "Electron microscopic examination of thin sections of parasites immunolabeled with these monoclonal antibodies and colloidal gold anti-mouse conjugate has confirmed that this antigen is localised in the rhoptry organelles of mature schizonts and free merozoites."
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during mature schizont and free merozoite
  • Comment: designation that this protein is RAP2 taken from 17553576
  • Comment: strain information not found
  • Other genes localised in this publication: rhoptry-associated protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_42878

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFE0080c rhoptry-associated protein 2
MGLKFYVLVFLILCLKNVVKGDKCETEFSKLYPESNSLTGLIYAHTANVHKLSMWVYFIYNHFSSADELIKYLEKTNINT
LENSDHTCFARAVTLYLFYYYLKDIKSMLSTDDYQSFFKNKFKDINPLFINDFILILNDKKFMENLDLYIMKESEREHLV
IKKNPFLRVLNKASTTTHATYKSNPYFIVGSRVHTPYKDYLGDFNKYTEISVLNYVRDYNFLIYAGSRENYYNSDIAGPA
RSVNNVISKNKTLGLRKRSSSLALVGTNNNDPIFAYCEKDNKSEYYGTPDDLITSFFSIIKTKMLNSHKTFLRQFDYALF
HKTYSIPNLKGFRFLKHLFQKKNLVNFVGMYENHVSTEINFLAEDFVELFDVTMDCYSRQYSNRAAENFKAIRELNVL

Gene-Specific Links for PFE0080c

General Sub-Cellular Localisation Links