ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0065w (SBP1, SBP)

skeleton-binding protein 1, a gene from Plasmodium falciparum

Compiled localisation
maurer's cleft during intraerythrocytic and ring and trophozoite
intraerythrocytic cysternae during schizont and trophozoite
during not ring

Who localised this protein by microscopy?

Kulzer, S., Rug, M., Brinkmann, K., Cannon, P., Cowman, A., Lingelbach, K., Blatch, G. L., Maier, A. G., Przyborski, J. M.
Parasite-encoded Hsp40 proteins define novel mobile structures in the cytosol of the P. falciparum-infected erythrocyte. (2010 Oct, Cell Microbiol) PubMed / full text
   more detail about this publication

maurer's cleft

Pachlatko, E., Rusch, S., Muller, A., Hemphill, A., Tilley, L., Hanssen, E., Beck, H. P.
MAHRP2, an exported protein of Plasmodium falciparum, is an essential component of Maurer's cleft tethers. (2010 Sep, Mol Microbiol) PubMed / full text
   more detail about this publication

maurer's cleft during trophozoite
  • "We undertook dual labelling of cells with a range of Maurer's cleft-associated proteins. Interestingly, we found no colocalization of MAHRP2 with MAHRP1, SBP1 or PfEMP"
  • Microscopy type: light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Maurer's cleft during trophozoite
  • Other genes localised in this publication: membrane-associated histidine rich protein 2, (MARHP2), membrane associated histidine-rich protein

Dixon, M. W., Hawthorne, P. L., Spielmann, T., Anderson, K. L., Trenholme, K. R., Gardiner, D. L.
Targeting of the ring exported protein 1 to the Maurer's clefts is mediated by a two-phase process. (2008 Aug, Traffic) PubMed / full text
   more detail about this publication

maurer's cleft
  • "To confirm the presence of REX-C5/C6 at the Maurer's clefts, colocalizations with the resident Maurer's cleft protein SBP1 were performed."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7, D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Maurer's Cleft
  • Comment: timing information not found
  • Other genes localised in this publication: ring-exported protein 1

van Ooij, C., Tamez, P., Bhattacharjee, S., Hiller, N. L., Harrison, T., Liolios, K., Kooij, T., Ramesar, J., Balu, B., Adams, J., Waters, A. P., Janse, C. J., Haldar, K.
The malaria secretome: from algorithms to essential function in blood stage infection. (2008 Jun, PLoS Pathog) PubMed / full text
   more detail about this publication

maurer's cleft during trophozoite

Nunes, M. C., Goldring, J. P., Doerig, C., Scherf, A.
A novel protein kinase family in Plasmodium falciparum is differentially transcribed and secreted to various cellular compartments of the host cell. (2007 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

maurer's cleft during ring

Cordery, D. V., Kishore, U., Kyes, S., Shafi, M. J., Watkins, K. R., Williams, T. N., Marsh, K., Urban, B. C.
Characterization of a Plasmodium falciparum macrophage-migration inhibitory factor homologue. (2007 Mar 15, J Infect Dis) PubMed / full text
   more detail about this publication

maurer's cleft during ring and trophozoite
  • "PfSBP1 has been shown to localise to the Maurers cleft [16."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: ITG/A4
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Maurer's Cleft during ring and troph
  • Other genes localised in this publication: macrophage migration inhibitory factor

Nyalwidhe, J., Lingelbach, K.
Proteases and chaperones are the most abundant proteins in the parasitophorous vacuole of Plasmodium falciparum-infected erythrocytes. (2006 Mar, Proteomics) PubMed / full text
   more detail about this publication

maurer's cleft during trophozoite
  • "To analyze the localization of the protein encoded by PfPV-1 morphologically, colocalization studies were carried out using mAbs against the human band 3 protein (localized in the erythrocyte membrane), against PfEXP-2 (a protein of the PV), and against PfSBP1, a protein that is associated with the so-called Maurers clefts, parasite-induced membrane structures associated with the erythrocyte cytoskeleton. "
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: FCBR
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Maurer's Cleft during trophozoite
  • Other genes localised in this publication: parasitophorous vacuolar protein 1, exported protein 2

Khattab, A., Klinkert, M. Q.
Maurer's clefts-restricted localization, orientation and export of a Plasmodium falciparum RIFIN. (2006 Dec, Traffic) PubMed / full text
   more detail about this publication

maurer's cleft
  • "Anti-GFP antibody reactivity (green) co-localizes with anti-PfSBP1 antibody recognition of the known MC protein (red)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: maurer's Cleft
  • Comment: C terminal of transmembrane domain is inside cleft
  • Comment: strain information not found
  • Other genes localised in this publication: rifin

Vincensini, L., Richert, S., Blisnick, T., Van Dorsselaer, A., Leize-Wagner, E., Rabilloud, T., Braun Breton, C.
Proteomic analysis identifies novel proteins of the Maurer's clefts, a secretory compartment delivering Plasmodium falciparum proteins to the surface of its host cell. (2005 Apr, Mol Cell Proteomics) PubMed / full text
   more detail about this publication

maurer's cleft

Lopez-Estrano, C., Bhattacharjee, S., Harrison, T., Haldar, K.
Cooperative domains define a unique host cell-targeting signal in Plasmodium falciparum-infected erythrocytes. (2003 Oct 14, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

maurer's cleft during trophozoite
  • "immunofluorescence assays (see Materials and Methods), and probed with antibodies to GFP (green) and a Maurer's cleft resident protein PfSBP (red)."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: maurer's cleft during troph
  • Other genes localised in this publication: histidine-rich protein II

Wickert, H., Wissing, F., Andrews, K. T., Stich, A., Krohne, G., Lanzer, M.
Evidence for trafficking of PfEMP1 to the surface of P. falciparum-infected erythrocytes via a complex membrane network. (2003 Jun, Eur J Cell Biol) PubMed / full text
   more detail about this publication

maurer's cleft during trophozoite
  • "Here we present evidence for a continuous membrane network of parasite origin in the erythrocyte cytoplasm. Co-localizations with antibodies against PfEMP1, PfExp-1, Pf332 and PfSbp1 at the light and electron microscopical level indicate that this membrane network is composed of structures that have been previously described as tubovesicular membrane network (TVM), Maurers clefts and membrane whorls. "
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain: HB3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Maurer's Cleft during troph
  • Other genes localised in this publication: antigen 332, DBL-like protein, circumsporozoite-related antigen, erythrocyte membrane protein 1, PfEMP1

Wickert, H., Rohrbach, P., Scherer, S. J., Krohne, G., Lanzer, M.
A putative Sec23 homologue of Plasmodium falciparum is located in Maurer's clefts. (2003 Jul, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

maurer's cleft during trophozoite
  • "PfSbp1 is a recognized Maurer's cleft specific marker"
  • Microscopy type: Fixed Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: maurer's cleft during trophozoite
  • Other genes localised in this publication: Pfsec23

Blisnick, T., Morales Betoulle, M. E., Barale, J. C., Uzureau, P., Berry, L., Desroses, S., Fujioka, H., Mattei, D., Braun Breton, C.
Pfsbp1, a Maurer's cleft Plasmodium falciparum protein, is associated with the erythrocyte skeleton. (2000 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

maurer's cleft during intraerythrocytic
  • "The carboxy-terminal domain of Pfsbp1, exposed within the cytoplasm of the host cell, interacts with a 35 kDa erythrocyte skeletal protein and might participate in the binding of the Maurer's clefts to the erythrocyte submembrane skeleton."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Uganda Palo Alto
  • Gene model mapping comments: Blast from AJ387723.1, inconsistent 5' UTR
  • Localisation record: Maurer's Cleft during intracellular
  • Comment: stage information not found, except that it was within RBC
  • Other genes localised in this publication: A common gene for all genes not assigned to a gene model, A common gene for all genes not assigned to a gene model

Li, W. L., Das, A., Song, J. Y., Crary, J. L., Haldar, K.
Stage-specific expression of plasmodial proteins containing an antigenic marker of the intraerythrocytic cisternae. (1991 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

intraerythrocytic cysternae during schizont and trophozoite, during not ring
  • "By indirect immunofluorescence and immunoelectron microscopy, LWLI bound to flattened intraerythrocytic cisternae exported into the erythrocyte cytoplasm"
  • Microscopy type: Light, EM
  • Microscopy method: monoclonal antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: intraerythrocytic cysternae during troph and schizont, not during ring
  • Comment: no fulltext available online
  • Comment: classification that the protein is PfSBP is from 14514891
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_50149

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PKH_103200 conserved Plasmodium protein, unknown function
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFE0065w skeleton-binding protein 1
MCSAARAFDFFTDLADEPTQLQDAVPETTEKLAEVVSDAATNVTDAVSDTASGIGSLVGEAASSLGNLVGEAASGIGNIV
GGAASGIGNIVGGAASGIGSLVGDAASGLGNLVGDAAEALATTELKDVIPENTESTTDLVPSEVSPPVDDYLDDDGFSSF
REFLESTPCWQRRMAQEALLNEYEVESPAESMSPILRVQFFADFAKQAVHVAKQNYLYVVIFLFFVINILLFINFYNLGK
RKGYYLAKKQKKEQMLEQNPEQNPEQNAQQNAQQNAQQNAQQNAQQNAQQNAQQNTQQNTQQKTQQNPQQNAQQNTQQNT
QQQSTTKSTTKTVARET

Gene-Specific Links for PFE0065w

General Sub-Cellular Localisation Links