ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0055c (PFE55)

heat shock protein 40, type II, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytosol
dot like structures in host cell and not erythrocyte plasma membrane and not maurer's cleft and not parasitophorous vacuole membrane during early trophozoite

Who localised this protein by microscopy?

Kulzer, S., Rug, M., Brinkmann, K., Cannon, P., Cowman, A., Lingelbach, K., Blatch, G. L., Maier, A. G., Przyborski, J. M.
Parasite-encoded Hsp40 proteins define novel mobile structures in the cytosol of the P. falciparum-infected erythrocyte. (2010 Oct, Cell Microbiol) PubMed / full text
   more detail about this publication

dot like structures in host cell and not erythrocyte plasma membrane and not maurer's cleft and not parasitophorous vacuole membrane during early trophozoite

Sargeant, T. J., Marti, M., Caler, E., Carlton, J. M., Simpson, K., Speed, T. P., Cowman, A. F.
Lineage-specific expansion of proteins exported to erythrocytes in malaria parasites. (2006, Genome Biol) PubMed / full text
   more detail about this publication

erythrocyte cytosol

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10242

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFE0055c heat shock protein 40, type II
MSILNKYEGKKNKIFLFIINIILFYTLEYVLIGSNYDKHNQSFGNEIFKNTKVFDFTSLRSLAEFNSGSSRESSKTDETD
YYAVLGLTKDCTQDDIKKAYRKLAMKWHPDKHLNDEDKVEAERKFKLIGEAYEVLSDEEKRKNYDLFGQSGLGGTTTNDE
AYYTYSNIDPNELFSRFFSHDASSFFSQGFDDFPSFQGFASMNSRRPRSSRSNIFSRSFGRAASFEVPLQVTLEELYTGC
RKKLKVTRKRFVGLNSYEDNTFITVDVKPGWSEGTKINFHGEGEQSSPNEQPGDLVFIIKTKPHDRFIREGNNLIYKCYL
PLDKALTGFQFSIKSLDNRDINVRVDDIINPNSKKIITNEGMPYSKSPSVKGDLFIEFDIVFPKKLSPEQKRTLKETLEN
TY

Gene-Specific Links for PFE0055c

General Sub-Cellular Localisation Links