ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFE0040c (MESA, EMP2)

mature parasite-infected erythrocyte surface antigen,erythrocyte membrane protein 2, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte plasma membrane during schizont and trophozoite
erythrocyte cytoplasm during trophozoite

Who localised this protein by microscopy?

Waller, K. L., McBride, S. M., Kim, K., McDonald, T. V.
Characterization of two putative potassium channels in Plasmodium falciparum. (2008, Malar J) PubMed / full text
   more detail about this publication

erythrocyte plasma membrane during schizont and trophozoite
  • "More diffuse RBC membrane labeling of MESA was detected on trophozoites and schizonts. No labeling was detected in rings (data not shown)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: diffuse RBC membrane during troph and schizont
  • Other genes localised in this publication: potassium channel protein, potassium channel protein, knob-associated histidine-rich protein

Chang, H. H., Falick, A. M., Carlton, P. M., Sedat, J. W., DeRisi, J. L., Marletta, M. A.
N-terminal processing of proteins exported by malaria parasites. (2008 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm during trophozoite
  • "PfEMP2-GFP is exported to the host RBC. "
  • Microscopy type: Light
  • Microscopy method: GFP tag after 87 amino acids
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Erythrocyte Cytoplasm during troph
  • Other genes localised in this publication: -

Magowan, C., Coppel, R. L., Lau, A. O., Moronne, M. M., Tchernia, G., Mohandas, N.
Role of the Plasmodium falciparum mature-parasite-infected erythrocyte surface antigen (MESA/PfEMP-2) in malarial infection of erythrocytes. (1995 Oct 15, Blood) PubMed / full text
   more detail about this publication

erythrocyte plasma membrane during trophozoite
  • "MESA was diffusely distributed in the cytosol of 4.1-deficient erythrocytes but was membrane-associated in normal erythrocytes"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Erythrocyte Plasma membrane during troph
  • Comment: strain information not found
  • Other genes localised in this publication: knob-associated histidine-rich protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10046

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFE0040c mature parasite-infected erythrocyte surface antigen,erythrocyte membrane protein 2
MEVICRNLCYDKKNNMMENEGNKVKKVYNNSSLKKYMKFCLCTIICVFLLDIYTNCESPTYSYSSIKNNNDRYVRILSET
EPPMSLEEIMRTFDEDHLYSIRNYIECLRNAPYIDDPLWGSVVTDKRNNCLQHIKLLEMQESERRKQQEEENAKDIEEIR
KKEKEYLMKELEEMDESDVEKAFRELQFIKLRDRTRPRKHVNVMGESKETDESKETDESKETGESKETGESKETGESKET
GESKETGESKETGESKETGESKETGESKETGESKETGESKETGESKETGESKETGESKETGESKETRIYEETKYNKITSE
FRETENVKITEESKDREGNKVSGPYENSENSNVTSESEETKKLAEKEENEGEKLGENVNDGASENSEDPKKLTEQEENGT
KESSEETKDDKPEENEKKADNKKKSKKKKKSFFQMLGCNFLCNKNIETDDEEETLVVKDDAKKKHKFLREANTEKNDNEK
KDKLLGEGDKEDVKEKNDEQKDKVLGEGDKEDVKEKNDEQKDKVLGEGDKEDVKEKNDGKKDKVIGSEKTQKEIKEKVEK
RVKKKCKKKVKKGIKENDTEGNDKVKGPEIIIEEVKEEIKKQVEDGIKENDTEGNDKVKGPEIITEEVKEEIKKQVEEGI
KENDTEGNDKVKGPEIITEEVKEEIKKQVEEGIKENDTESKDKLIGQEIITEEVKEGIKENDTENKDKVIGQEIITEEVK
EGIKENDTENKDKVIGQEIITEEVKKEIEKQEEKGNKENILEIKDIVIGQEVIIEEVKKVIKKKVEKGIKENHTESKDKV
IGQEIIVEEVKEEIEKQVEEGIKENDTESKDKVIGQEVIKGDVNEEGPENKDKVTKQEKVKEVKKEVKKKVKKRVKKRNN
KNERKDNVIGKEIMKEDVNEKDTANKDKEIEQEKEKEEVKEKEEVKEKEEVKEKEEVKEKEEVKEKEEVKEKEEVKEKEE
VKEKDTESKDKEIEQEKEKEEVKEVKEKDTENKDKVIGQEIIIEEIKKEVKKRVKKRNNKNENKDNVIVQEIMNEDVNEK
DTANKDKVIEQEKEKEEVKEKEEVKEKEEVKEKEEVKEKEEVKEKEEVKEKDTESKDNVIVQEIMNEDVNEKDTESKDKM
IGKEVIIEEVKEEVKKRVNKEVNKRVNRRNRKNERKDVIEQEIVSEEVNEKDTKNNDKKIGKRVKKPIDDCKKEREVQEE
SEEESEEESEEESEEESEEESEEESEEESEEESEEESEEESEEESEEESEEESEEESEEESEEESEEESDEEKNTSGLVH
RRNCKKEKKYNNGELEEYYKEKQNEEYFDEEYIIQSKEHNTLNTFPNMALNEDFRREFHNILSIHEDTDLMELKRILYNL
FLEYNPHMNNKQKAELDKKFSEMNVVHQILNYEERIRMYEENAARGRLNTVILDPIITFNVIFGDDTMFKFIDE

Gene-Specific Links for PFE0040c

General Sub-Cellular Localisation Links