ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFD1160w (SURFIN4.2, Surf4.2)

surface-associated interspersed gene 4.2, (SURFIN4.2), a gene from Plasmodium falciparum

Compiled localisation
during not early trophozoite and not ring
parasitophorous vacuole close to food vacuole during late trophozoite
parasitophorous vacuole during 24 hours after merozoite invasion and schizont
merozoite associated material during early schizont and extracellular merozoite and late schizont
apical during extracellular merozoite and merozoite
erythrocyte cytosol and erythrocyte plasma membrane and single small vesicle in erythrocyte during 24 hours after merozoite invasion
parasite plasma membrane during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Mphande, F. A., Ribacke, U., Kaneko, O., Kironde, F., Winter, G., Wahlgren, M.
SURFIN4.1, a schizont-merozoite associated protein in the SURFIN family of Plasmodium falciparum. (2008, Malar J) PubMed / full text
   more detail about this publication

during not early trophozoite and not ring, parasitophorous vacuole close to food vacuole during late trophozoite, parasitophorous vacuole during schizont, merozoite associated material during early schizont, apical during extracellular merozoite
  • "When a SURFIN4.2 antibody was used on the same parasite stages, the same pattern of staining was achieved for both trophozoite and early schizont stages. However in the ruptured schizont, SURFIN4.2 antibody showed a distinct staining of the merozoite apex while the pattern observed with SURFIN4.1 antibody was not apical but rather spread around the merozoite (Figure 3)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7S8, FCR3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not during ring and early troph, spot in parasitophorous vacuole close to food vacuole during late troph, dotty PV during mature, merozoite associated material during intact schizont, apex during free merozoite
  • Other genes localised in this publication: surface-associated interspersed gene 4.1, (SURFIN4.1), erythrocyte binding antigen-175, merozoite surface protein 1

Winter, G., Kawai, S., Haeggstrom, M., Kaneko, O., von Euler, A., Kawazu, S., Palm, D., Fernandez, V., Wahlgren, M.
SURFIN is a polymorphic antigen expressed on Plasmodium falciparum merozoites and infected erythrocytes. (2005 Jun 6, J Exp Med) PubMed / full text
   more detail about this publication

erythrocyte cytosol and erythrocyte plasma membrane and parasitophorous vacuole and single small vesicle in erythrocyte during 24 hours after merozoite invasion, merozoite associated material and parasite plasma membrane during extracellular merozoite and late schizont, apical during merozoite
  • "3D7surf4.2-encoded SURFIN is colocalized with proteins (PfEMP1 and RIFIN) exported to the erythrocyte cytosol and PM Double staining of 3D7S8 parasites with PfEMP1-directed antibodies and anti-S1.3 serum revealed that, in ~25% of trophozoites, SURFIN4.2 and PfEMP1 colocalized in single small vesicles (SSVs), which were previously implicated in PfEMP1/RIFIN transport (reference 12; Fig. 5 B)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper, blast from AB207820, annotation matches
  • Localisation record: Erythrocyte Surface and PV and erythrocyte cytosol and single small vesicles during 24 hours after merozoite invasion, MAM and PM during late schizont and free merozoite, crescent shaped cap associated with apical pole during merozoite
  • Other genes localised in this publication: apical membrane antigen 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20022

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • MAL8P1.1 surface-associated interspersed gene 8.1, (SURFIN8.1)
  • MAL8P1.162 surface-associated interspersed gene 8.3 (SURFIN8.3)
  • PF08_0002 surface-associated interspersed gene 8.2 (SURFIN8.2)
  • PF13_0075 surface-associated interspersed gene 13.1 (SURFIN13.1)
  • PF14_0747 surface -associated intersprsed gene 14.1 (SURFIN 14.1)
  • PFA0625w surface-associated interspersed gene 1.1 (SURFIN 1.1)
  • PFA0650w surface-associated interspersed gene (SURFIN), pseudogene
  • PFA0725w surface-associated interspersed protein 1.3 (SURFIN 1.3)
  • PVX_025190 Pvstp1, truncated, putative
  • PVX_077195 Pvstp1, putative
  • PVX_090285 Pvstp1, putative
  • PVX_112625 Pvstp1, truncated, putative
  • PVX_128260 Pvstp1, truncated, putative
  • PVX_132260 Pvstp1, truncated, putative
  • PVX_165265 Pvstp1, truncated, putative
  • PVX_166265 Pvstp1, truncated, putative
  • PVX_242295 Pvstp1, truncated, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFD1160w surface-associated interspersed gene 4.2, (SURFIN4.2)
MLFVVELDSRLEKSADKRISVERFRKIFEIYVEDKLEELKRSGSEKYDKDCRDFNYFIDDVKDVFINNDLVKIPVKVRKS
IWETHVDKNLPKLMKNTTSCKCIRKEHNYNKEYRDMTRTLEDFCEEKTRKLEIIYQKDYDESLYVNFNEWINKKKEDILK
EYEKLSNKDKYKHLLKISETCDLNHVDKLFLNISSEDMKKMKEDVKKQHLEVKVRPPVNEPIDDRGKEDALSRGGKSIIL
NKEENSPTEEITTEYNPVSEMGVGTTIAHSEPGPKTVNTEVRNVLRSDGKISDQGSQKSPPKELSNKQMTPAQRKNVPHF
VERRGYGNSHVRGNALKKISNGDDNYKSPSSNYIEVDCAEDKYFLLEDGTNQSENSCKTKYNYFVSNDYDGTGSAIYSTD
QVPSREEIKSPDSLSTLDARGSTHNLNVSNEGNPLEGGEEKNNVKISEQNGRNLESSVGTDKGSDKNEEEVAATCDPNDR
NCFDGRYINVDYIRGLLKGKRSGSDGRSNIKHIISNNFDDSNMIFPTFNFDFDILKAEEEVLPVNNSDIIYGHEEVEETT
QEGASIFEKHSHTSSQQNDSSASGNKYRMLSTTMELPNQQEVFGLYSPVSRTLDSAMSFLRSIISLSSAPVSRSEGQSKE
SKRVEISTTVQDPIGYRTSPLQMNAHSVGAGINVSSILSMLGLSSGQVRRSGGQGSETYIVGTSQSGFHKNEVIPSIKDK
SGKTQIVSNEKGGIFSKGITSMMSSLPVALVTFVFLFMFLVFNKMNPFGTTIVQGKKKKKVKQKLGERKKPKRRSAKRRR
GVDVNMEEEINKIIYTNEFNNYEDKIYEDVKYIKEQENEMYLRDGIEELHMDEPSGDVYFDDQDDYIFLDEQKEDVCLDE
AKNDILSKESFDDVLIKVVDREINREINGKINGEINREINGEINGEMNREINREINGEINGKINREINREINGEIPLKKE
KWMWKTILEIEMKVVEKCKKEEWEESKGDFLEICLDEFIKKENEYNKIHNKVIIEKSVLENQNMLWNKWIERHRYMLEKW
KKEEWFYNLKNEWINEIENYEKKESDIEIILPSEKKTRNISLEKQKIIWRRWVARYVQHIDDDIIEEWFKKMMAEYEKEE
YYLNKNRYKIINHIRNRNDKHDENVQCDDEESLVSSSICFDVEEKKKKNLLTKIWFQIHMMILEEYKKDECIHIKNLLLD
NYIDNLKKKNELDAKKKLQKLDILNEMKKENNIIDINERNKWEGEKWFEDLNNEWNDYERTYIKNNFVIKKENDMNIKYE
YIIIDEPLMKVKKDIPQMHWKNIYEKWLHDEYKYVYRCEDINKSVDEKRDNNIDIGESINVKNNEVMKEKKVKWKTIIEI
YMEVMNEYKKDEWEEHRGDFLQICLEEFIKKDNDEMRNINDELYIEQSDHMEDMLMLERQKIRWLQWINRNKYMLEKWNK
EEWFCKLKKDWEDEKNRYDEKLFLWKNTENDKYINPMLERQKYIWRKWIAKHLYHIDEWENEEWFKLLMSTYEKDRDDLK
RDHPINKMDDMEKKKLITKLFIEIHMMVIEDFKKEECYRNKQTFVDTYINEMKKEEPCEKNREMLNILNNIKKDIKLGYE
NTKMNEWKEEKWFDKLKKEWKEGECKNFVDIEKENFDKTQVNVINNYMLEIQRSLLKKYWQDVEISWIDDDNQTDWLKIA
IHMDDYDNKNKVYNRRHDYMRNKNLHVKKKKNIINEDHLSEDNKYLHENNHSYIKRIIEIYMERVNKIQKKEWEENKRDF
LKIALAEYIKMQFDKQKNLCIEEMVIKNKNINDDNNGYLEPAFLWNQWVERKRYIMEKWKYEKWFEELKIEWVKEQGIYI
KEEEINTFMKDEKKENNKIIHNDKIIHNDKIIHNDKIIHNNKIINNNNDILIESEKIVWRRWLKKQEQNIQIYKNKKWFK
DIIVEFEKDEEDDMIMYSNVNDISKVNNKEVDVNNRDNLIMKIWICICMMILEECKKDEGRYNKEIFLNSFIKEIKKEKD
EKIKMNMLDMILQMKEKYISKNEKDFYIYDWKKEKWFEDLKNDCKNNKNEYIYMLQNDLCKRYWKDLDKMWLENEDKIKR
NMLTNIYEEYNNMDDLSKKEYIHKNINIINENMKCNSEVEKTHGEHTVEGIKNYYLEKQKEIWRQWIEKNVKHINQSTKE
QEQILVDTENNKIVNSSDCKKNENKNEPYYMKKKNLKTVFLAEIHMETMDRCKGLNYKGEDKIETDENIKELKIEEGENS
KTNYIHKTILPKDECKKSKLSLNEENKMCKHKNMKENKINDLDNSIYTNLYDDTNKFFFFNENCEGVKSIYQEIEENVEK
RYTDDIYLLENEKHHNEFNTHMGENNYDVKEKMDDRNNKNCYMRSYIKPRDKKKNTENKT

Gene-Specific Links for PFD1160w

General Sub-Cellular Localisation Links