ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFD1155w ()

erythrocyte binding antigen-165, a gene from Plasmodium falciparum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_31615

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFD1155w erythrocyte binding antigen-165
MRKTLKLFYISGFLFSSRALCKLENYIKNEYDRENSFYILNNKVEKEYEKGTNNNINIDNKKEALLEDKKNVDNKDIKEQ
LPENNKNFEEKILHEDICKLNKENIEKEGLYKPNTFKSIGNDLLYKKGKLNFLYEYGMELLHINKVPMNRMNNSRGLGDS
NMSFLDISNNNMNSLNSMNNLNNSNNFDSSNSLSFVDMKSIHRCIKKRAKGERDWACNDKNTKEPNICVSDRRVQLCTGN
LIELPINDSTKEKFKEKLILAAQKEGSLLFEKFGKKYNEEFCLNLKWSYGDYGDIIKGTDMEGLGRSIKVEFEIDRIFKR
DNKKSAENRKKWWEEISTHIWNAMIKEHKEKFPKDVKECSADKPLDEPQINRWLMEWAYDTDYNKNLWYNKLDDSKNKCN
RICPKKRNFSLYKTAFEYLKQKWDKYKELNFSSIFDQLNAKYYNKCICQNNKIENNALYVKIEDICNNTKVKSIYGELYC
KEKGNDKIWQCINEHIKDFPDVCGPPRRQQLCLGNLDKDEFKNVNDLKKFLNEIILGIRDEGKFLIEKYRKNMHENMYLD
ERACKYLNYSFDDYKNIILGKDMWRDPNSIKTENILKGNFEGIKANIVSMYPSYADLSLDEFRKHWWDQNKKQLWEAISC
EFYKGNHTGVCLMEDDNDNQYLHWFREWKNDFCIDKLKWNDVIKEPCIDKKVKSPKPSENPSDVATVCNKSCTDYDKWII
NKRKEYKMQSSKYKRDRSLFNNVIQNLKPWEYLSMKCTECTCNLDTQTFVYPYKGYEDICKSTVKPYDPEDIKDEEFNEP
SLNVNPLSLTSQDVTERVSSVDDVLSIKENVDLKPFKPKGGTQSSHVDQVGNPRESESKPSGANGREDPSTESSTYNDGV
ITSSSSLGSSSGRDVSSSPVGVGDEHEAKELLPPQKIIDGVTQSDESTLSQHGKESSQEQHNLDGSSLSRHSNQDEERSI
ITSDVEHGTNSLFGSQIQDQETILGESEPLTTSPPEHETSKMDTHAGGKNMEQVRNASVDSSSEMSNGGRGGLKTKEMKG
EEVTGITSKNDINLEDSTVHSRQNKIENSGDNTQGKEHINVLQGMDKHLENPPTSERGDSVLESEFSKLNRTSHTHDNNR
IETTAENNIGGLSNSNVHDGRDSQRNRMHINSRSRHGSLESDIVVRGDDISNIEGGEEEEEDANTLKYPRNVLNNKNSRT
YNIEEYIYRDVNKVADDIMRSYKSNRCTNNLSSNYCSKLKKESLSNTCTNEDSKRLCCSISDYCMKFFNFNSSGYHSCMR
KEFSNHAYKCFAGKGFSNMYYFAGGGLFFIILFLLGAKSSILNWSEDNELNGTAFEEANFEDAAFEVTTGQDSAFEDYDE
NAYRIGLLMNQKIQSAKSSDYLEYHVDN

Gene-Specific Links for PFD1155w

General Sub-Cellular Localisation Links