ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFD1110w (GAPM2)

glideosome associated protein with multiple membrane spans 2, a gene from Plasmodium falciparum

Compiled localisation
inner membrane complex during extracellular merozoite and late schizont and ring and schizont and trophozoite

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

inner membrane complex during extracellular merozoite and late schizont

Bullen, H. E., Tonkin, C. J., O'Donnell, R. A., Tham, W. H., Papenfuss, A. T., Gould, S., Cowman, A. F., Crabb, B. S., Gilson, P. R.
A novel family of Apicomplexan glideosome-associated proteins with an inner membrane-anchoring role. (2009 Sep 11, J Biol Chem) PubMed / full text
   more detail about this publication

inner membrane complex during ring and schizont and trophozoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23364

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_052390 conserved Plasmodium protein, unknown function
  • PY06455 hypothetical protein
  • PVX_090215 hypothetical protein, conserved
  • PCHAS_052410 conserved Plasmodium protein, unknown function
  • PKH_052700 hypothetical protein, conserved in Apicomplexan species
  • NCLIV_044350 hypothetical protein, conserved
  • cgd6_2220 membrane-associated protein with 6 transmembrane domains possible apicomplexan conserved, duplicated adjacent gene
  • Chro.60260 multi-pass transmembrane protein
  • CMU_007650 hypothetical protein, conserved
  • TP01_0761 hypothetical protein, conserved
  • TA06890 hypothetical protein, conserved
  • BBOV_IV010960 conserved hypothetical multi-pas transmembrane protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFD1110w glideosome associated protein with multiple membrane spans 2
MGSYGMDVDDAYLHQGQYAAPYDNQYQQDDDTPSPRGENHTPFVGYFSSHLLRTGFFLQCVSLVLMFVFYWAFGGTGIFI
FDLYAGPECVKVSSTFHLTISILMALYLLGTLYIAMFQVFVADNSKWCRGFRAGSKLLSAAVTLDLLSSILRLVQYLYAY
FYMSMRWWARYQQTKSDWTLLHFGSIVHSFALFIYGAAFFYMEAYHDEGTYEELAWSNLTLFKLAGLAELIMVFSGFGAF
FSILLLGAIVCATVWAFSFEPLLEKWSPELHSRDINADVLPEIKHEDEQCAYNEENIYEPYSVNPDNVEYGEEMVAKNMN
EKYIDGNTYDSNIYSANNGIPTTYDYTQIEGQLKKNVEMGVTENNYIKTAQY

Gene-Specific Links for PFD1110w

General Sub-Cellular Localisation Links