ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFD1105w (AARP)

asparagine-rich protein, a gene from Plasmodium falciparum

Compiled localisation
rhoptry neck during merozoite and schizont
not rhoptry bulb and nowhere except rhoptry during merozoite and schizont
during not ring and not trophozoite
apical during extracellular merozoite and late schizont
not microneme during schizont

Who localised this protein by microscopy?

Srivastava, A., Singh, S., Dhawan, S., Mahmood Alam, M., Mohmmed, A., Chitnis, C. E.
Localization of apical sushi protein in Plasmodium falciparum merozoites. (2010 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry neck and not microneme during schizont
  • "Sera against the rhoptry neck protein,PfAARP, were used to confirm localization of PfASP in rhoptry neck. PfASP co-localized with PfAARP at the apical ends of merozoites (Fig. 2C). "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry neck and not microneme during schizont
  • Other genes localised in this publication: apical sushi protein, cytoadherence linked asexual protein 3.2, erythrocyte binding antigen-175

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

apical during extracellular merozoite and late schizont

Wickramarachchi, T., Devi, Y. S., Mohmmed, A., Chauhan, V. S.
Identification and characterization of a novel Plasmodium falciparum merozoite apical protein involved in erythrocyte binding and invasion. (2008, PLoS One) PubMed / full text
   more detail about this publication

nowhere except rhoptry and rhoptry neck and not rhoptry bulb during merozoite and schizont, during not ring and not trophozoite
  • ".These results suggest that PfAARP is present at the apical end of the merozoites close to the rhoptry neck. To confirm these results we carried out immuno-elctron microscopic studies using anti-PfAARP antibodies. PfAARP staining was found to be localized in the apical ends of rhoptries, close to the rhptry neck area, where the two rhoptries join in a common ductule (Figure 7). No staining was found in the rhoptry bulbs or any other organelle of the merozoites."
  • Microscopy type: Light, EM
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: rhoptry ductule and not rhoptry bulb and nowhere except rhoptry during schizont and merozoite, not during ring and troph
  • Other genes localised in this publication: merozoite surface protein 1, apical membrane antigen 1, erythrocyte binding antigen-175, cytoadherence linked asexual protein 3.2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48504

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFD1105w asparagine-rich protein
MWKFITIIIFSIYYIDGKSILRNNKSHNNLPISKTNEEEEGKININNLKPIKQHDNIIEDVHIKENKFISIKNKDKNGSF
IDLSMRYNEKESDNDEEEEEDEEDNEDNNTNNNNNNNNNNNNDDDHHNDDDHHDNNDNHDNDNNDNNNNNNDNNNNNNDN
NNNNNDNNNNSSAAFTALPPPPPPVPPPPPPTLTPSGIVGNVLSTFVSHGLKLIGVP

Gene-Specific Links for PFD1105w

General Sub-Cellular Localisation Links