ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFD1050w (alpha tubulin II, a-tubulin II)

alpha tubulin 2, a gene from Plasmodium falciparum

Compiled localisation
during emerged male gametocyte and emerging gametocyte and exflagellating male gametocyte and male gametocyte stage iii and male gametocyte stage iv and male gametocyte stage v and male gametocyte and not female gamete and not female gametocyte and not intraerythrocytic and not sporozoite

Who localised this protein by microscopy?

Pradel, G.
Proteins of the malaria parasite sexual stages: expression, function and potential for transmission blocking strategies. (2007 Dec, Parasitology) PubMed / full text
   more detail about this publication

during male gametocyte

van Schaijk, B. C., van Dijk, M. R., van de Vegte-Bolmer, M., van Gemert, G. J., van Dooren, M. W., Eksi, S., Roeffen, W. F., Janse, C. J., Waters, A. P., Sauerwein, R. W.
Pfs47, paralog of the male fertility factor Pfs48/45, is a female specific surface protein in Plasmodium falciparum. (2006 Oct, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

during male gametocyte and not female gametocyte
  • "These IFAs showed that all -tubulin-II positive (red) gametocytes were negative for Pfs47 (green), whereas Pfs47 positive gametocytes were negative for -tubulin-II"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: NF54
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during male gametocyte, not during female gametocyte
  • Other genes localised in this publication: 6-cysteine protein

Eksi, S., Williamson, K. C.
Male-specific expression of the paralog of malaria transmission-blocking target antigen Pfs230, PfB0400w. (2002 Jul, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

during male gametocyte stage v
  • "The stage V gametocytes that were positive for PfB0400w also stained with anti--tubulin II antibodies and exhibited diffuse nuclear staining with 4,6-diamidino-2-phenylindole (DAPI), suggesting that they were male gametocytes (Fig. 2A)"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody against homologue
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during stage V male gametocyte
  • Comment: localisation not annunciated
  • Comment: strain information not found
  • Other genes localised in this publication: 6-cysteine protein

Silvestrini, F., Alano, P., Williams, J. L.
Commitment to the production of male and female gametocytes in the human malaria parasite Plasmodium falciparum. (2000 Nov, Parasitology) PubMed / full text
   more detail about this publication

during male gametocyte stage iii
  • "However, the vast majority of gametocytes, 1623 (94n9 %), were stained in a mutually exclusive fashion by only 1 of the 2 sex-specific antibodies: 1504 reacted only with anti-Pfg377 antibodies, and were classified as females, and 119 reacted only with anti--tubulin-II, and were classified as males. "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: NF54
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during stage III male gametocyte
  • Other genes localised in this publication: osmiophilic body protein

Rawlings, D. J., Fujioka, H., Fried, M., Keister, D. B., Aikawa, M., Kaslow, D. C.
Alpha-tubulin II is a male-specific protein in Plasmodium falciparum. (1992 Dec, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

during emerged male gametocyte and emerging gametocyte and exflagellating male gametocyte and male gametocyte stage iii and male gametocyte stage iv and male gametocyte stage v and not female gamete and not intraerythrocytic and not sporozoite
  • ""
  • Microscopy type:
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: Taken directly from 18257930
  • Localisation record: during stage III male gametocyte and stage IV male gametocyte and stage V male gametocyte and emerging gametocyte and exflagellating male gametocyte and free male gametocyte, not during female gamete and sporozoite and asexual
  • Comment: no fulltext available online
  • Comment: Was this done by microscopy
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10075

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFD1050w alpha tubulin 2
MREVISIHVGQAGIQIGNACWELFCLEHGIQPDGQMPSDQVVAGGDDAFNTFFSETGAGKHVPRCVFVDLEPTVVDEVRT
GTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDVCLDRVRKLADNCTGLQGFLMFNAVGGGTGSGLGCLLLERLAID
YGKKSKLNFCSWPSPQVSTAVVEPYNSVLSTHSLLEHTDVAIMLDNEAIYDICKKNLDIERPTYTNLNRLIAQVISSLTA
SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVSEITNSAFEPASMMAKCDPRHGKYMACCLMYR
GDVVPKDVNAAVATIKTKRSIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTAIAEVFSRMDQKFDLMYA
KRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIESNDGEGEDEGYE

Gene-Specific Links for PFD1050w

General Sub-Cellular Localisation Links