ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFD0825c (Puf2)

RNA binding protein Puf2, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm during female gametocyte and male gametocyte
during not merozoite and not ring and not schizont and not trophozoite

Who localised this protein by microscopy?

Miao, J., Li, J., Fan, Q., Li, X., Li, X., Cui, L.
The Puf-family RNA-binding protein PfPuf2 regulates sexual development and sex differentiation in the malaria parasite Plasmodium falciparum. (2010 Apr 1, J Cell Sci) PubMed / full text
   more detail about this publication

cytoplasm during female gametocyte and male gametocyte
  • "Tagging of the endogenous PfPuf2 protein with green fluorescent protein showed that PfPuf2 was expressed in both male and female gametocytes, and the protein was localized in the cytoplasm of the parasite."
  • Microscopy type: Fixed Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: cytoplasm during male gametocyte and female gametocyte
  • Other genes localised in this publication: -

   20197405 (unpublished) full text
   more detail about this publication

during not merozoite and not ring and not schizont and not trophozoite
  • "Consistent with its sexual-stage-specific expression, GFP was not observed in asexual stages (data not shown)."
  • Microscopy type: Fixed Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not during asexual stages
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10403

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFD0825c RNA binding protein Puf2
MDSIFLEDDAIGHVNNIDHINDINNIGVINNTNNINNVNDVVDEFNFKDQLKHLKNMKTCSTSYNSMPSSNIEMLFDQEL
MGNQNILFLNDPENDIFNFSRGIIKDEYYKNYYIHKENQEKIDYNQIYHNFENNHNFEYFKNSEHYEKSPEQVIDNKRYY
ENLPEQVIINKKDMFKNDEEKHNEEGQVHIDMSKVMYDIYFLCFHKNGCEYIIKKLKEDNKEEKEIILNSLLIDTMSLCP
DIYGSYVAQSIFDLKDEKYKERFTDEFLKHTSFLTLHTYGCRLIQKSLESLSDEYKCKIFKELQEDLIKYICHQNGNHVI
QKCVEVLPCSYIDIIINIIEEYLPFLSSHAYGCRIVQRIYEIGNEQQINRLNEQIIKKIHLIKNRYGNYVIQKCFEHSDD
NIRFIITDEIVNDIYKLSSHKYACNIIEKILLKKEYKYKKKIIKKIVNDISDGKDNIINICKDCYGNFMMQKLLTTCRKK
ERNFIIKTIIENLDKLKDETYGKYILRAINNLEK

Gene-Specific Links for PFD0825c

General Sub-Cellular Localisation Links