ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFD0810w (Sar1p, Sar1)

small GTP-binding protein sar1, a gene from Plasmodium falciparum

Compiled localisation
endoplasmic reticulum and not erythrocyte cytoplasm during merozoite and ring and schizont and trophozoite
cytoplasmic vesicle and erythrocyte cytoplasmic vesicle during ring and schizont

Who localised this protein by microscopy?

Adisa, A., Frankland, S., Rug, M., Jackson, K., Maier, A. G., Walsh, P., Lithgow, T., Klonis, N., Gilson, P. R., Cowman, A. F., Tilley, L.
Re-assessing the locations of components of the classical vesicle-mediated trafficking machinery in transfected Plasmodium falciparum. (2007 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum and not erythrocyte cytoplasm during merozoite and ring and schizont and trophozoite
  • "The data indicate extensive overlap of GFP and ER tracker, although the fluorescence signal from the bright GFP-labelled puncta within individual merozoites is somewhat more pronounced (Fig. 3A, bottom panel and B, top panel, arrows). In cells co-labelled with the nuclear stain, 4',6-diamidino-2-phenylindole (DAPI), the GFP fluorescence surrounds the nucleus (Supplementary Fig. S1A and B) supporting the suggestion that the GFP-labelled structures represent the ER of the parasite. Antibodies against GFP gave a similar labelling pattern in the parasite cytoplasm but no labelling in the RBC cytoplasm (Fig. 3C, lower panel, green)."
  • Microscopy type: Light
  • Microscopy method: N terminal GFP tag, C terminal GFP tag, antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER and not RBC cytoplasm during ring and troph and schizont and merozoite
  • Other genes localised in this publication: Bet3 transport protein, putative, golgi re-assembly stacking protein 1, Rab GTPase 6

Adisa, A., Albano, F. R., Reeder, J., Foley, M., Tilley, L.
Evidence for a role for a Plasmodium falciparum homologue of Sec31p in the export of proteins to the surface of malaria parasite-infected erythrocytes. (2001 Sep, J Cell Sci) PubMed / full text
   more detail about this publication

cytoplasmic vesicle and erythrocyte cytoplasmic vesicle during ring and schizont
  • "A polyclonal mouse antiserum against PfSec31(WD) gave an equivalent labelling pattern to that observed with the rabbit antiserum (Fig. 6f,j). A rabbit polyclonal antiserum that recognises the COPII protein, PfSar1p, gave a very similar labelling pattern (Fig. 6g,k), as judged by the almost complete overlap of the fluorescence patterns obtained using probes for these two proteins (Fig. 6h,l)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: K1
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Cytoplasmic vesicles and RBC cytoplasm vesicles during ring and schizont
  • Other genes localised in this publication: sec31p, endoplasmic reticulum-resident calcium binding protein, erythrocyte membrane protein 3, circumsporozoite-related antigen

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10790

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFD0810w small GTP-binding protein sar1
MFIINWFRDILAHLGLSQKSARILFLGLDNAGKTTLLHMLKDDRVAQHVPTLHPHSEELVVGKIRFKTFDLGGHETARRI
WRDYFAAVDAVVFMIDTTDRSRFDEAREELRHLLETEELSNVPFVVLGNKIDKPDAASEDELRQHLNLFSNITVHNNMKG
GSGVRPVELFMCSVIRRMGYAAAFKWISQFLT

Gene-Specific Links for PFD0810w

General Sub-Cellular Localisation Links