ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFD0720w ()

conserved ARM repeats protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
apical during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

apical during extracellular merozoite and late schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_24403

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_071690 conserved Plasmodium protein, unknown function
  • PY02199 hypothetical protein
  • PVX_089700 hypothetical protein, conserved
  • PCHAS_072600 conserved Plasmodium protein, unknown function
  • PKH_051860 hypothetical protein, conserved in Apicomplexan species
  • TGME49_061440 armadillo/beta-catenin-like repeat-containing protein
  • NCLIV_026070 armadillo/beta-catenin-like repeat-containing protein, putative
  • cgd2_370 ARM repeats containing protein
  • Chro.20044 hypothetical protein
  • CMU_002240 armadillo/beta-catenin-like repeat family protein
  • TA05340 hypothetical protein, conserved
  • BBOV_I001940 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFD0720w conserved ARM repeats protein, unknown function
MGNNCCAGRDLLYKNKLQEFGIEGSKTIRKLLSFTSNDILRFDKAYDENDVQEFVNLCSSTCEIEKLEDRMHPWAADPKT
IGALSATQLAILASKENEPHYKDAIREANGIAVFINLLKSHELDRVHAAVVALSFLSVDNVKNCICMFESGALPYLISGM
KSNIDGMKAACAQTCRNIFVLDKKYKKEFLKLGGITQLVNLLELPSNYDDSQPLYTQLEAIYHLEDFILNDGDEIPEFLE
AVKNSNSIKNLKTLQQCPEQDLAEASNVLLLRLTD

Gene-Specific Links for PFD0720w

General Sub-Cellular Localisation Links