ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFD0495c (EVP1)

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytosol during 18-36 hours after merozoite invasion and intraerythrocytic
cytoplasm and erythrocyte cytoplasmic structure during intraerythrocytic

Who localised this protein by microscopy?

van Ooij, C., Tamez, P., Bhattacharjee, S., Hiller, N. L., Harrison, T., Liolios, K., Kooij, T., Ramesar, J., Balu, B., Adams, J., Waters, A. P., Janse, C. J., Haldar, K.
The malaria secretome: from algorithms to essential function in blood stage infection. (2008 Jun, PLoS Pathog) PubMed / full text
   more detail about this publication

erythrocyte cytosol during 18-36 hours after merozoite invasion

Tamez, P. A., Bhattacharjee, S., van Ooij, C., Hiller, N. L., Llinas, M., Balu, B., Adams, J. H., Haldar, K.
An erythrocyte vesicle protein exported by the malaria parasite promotes tubovesicular lipid import from the host cell surface. (2008, PLoS Pathog) PubMed / full text
   more detail about this publication

cytoplasm and erythrocyte cytoplasmic structure and erythrocyte cytosol during intraerythrocytic
  • "FD0495c is found within intraerythrocytic structures, and protein synthesis of the endogenous and transgene product is in-phase and overlapping."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: Erythrocyte Cytosol and parasite periphery and intraerythrocytic spots during asexual
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_42735

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFD0495c conserved Plasmodium protein, unknown function
MYKKCFILYPIFFPSLYIYIIKNDHLNSEQSSFSRIIAEYCDTKKNEFFLGESILGATSSRSTSLNIEQNKNTNIIKDKN
EQSYDEHIVMNPNTNRALSINTVFNYNKENKEKKIFSFSEFPKEFNILDVVWPYMKQPKELFKKSSVITFLMDHYFRHEL
YILESRIAMKPRRRTYEAPCFEHDDFELERDFFFLEDCDEDHQFFNKYKSYFFSLNVLDHCKSLRTKKQKCNNMKDDEVS
NINDDEVSNINDDEVSNINDDEVSNIKDDVVRNINDDVVRNINDDEVHHTNDDKVNHTNDDKVNHTNDDKVNHTNDDKVN
HTNDDKVNHTNDDNVNHTNDDKVNHTNDDKVNHTNDDKVNHTNDDKVNHTNNYYNDKKNNAGDIKTNNSIREEKKLEHPD
RNIEKKIDLITYNKKRIEEYYDSIISYFFGLIILYHNKKETNLNYYTKFLTLDKYKNMYNCLNNDISKIYEKAILFSHEE
FCIIQKKDLKPHGLRGNIKYYYFFNRIVSTSLYLLHEILQKLDGKMYTFQKLPLKIQNHLINLPDIRIKEIKKRMRQQKK
KNQNSLLESSSYKDLYYVSSEYYDYVSKCLIWSNYYFFNYMSTTIVYSVKKRSYEYIQKEKSKINLFLEYAHNDIIEYIK
DITYYFKLIVNKIESKRLFSEPVMLCFQLFSDHYLYLLKNILSILLIHIEKPVTRKSNRDLKKIFNCIKDQENITKNILD
EFHSKNKIRYNPTEFLIYKFFSSIQYKQNIAHKYIIQSNINIISLMLKIFNYFHILVISLIFYLNLHSMYTLFIDLDIDD
TLKFQHDQEFLNYFKRYQDFNNQLFDSFRSDDR

Gene-Specific Links for PFD0495c

General Sub-Cellular Localisation Links